KEGG   Enhydra lutris kenyoni (northern sea otter): 111142072
Entry
111142072         CDS       T05871                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04151  PI3K-Akt signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04934  Cushing syndrome
elk05162  Measles
elk05165  Human papillomavirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05203  Viral carcinogenesis
elk05206  MicroRNAs in cancer
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111142072
   04066 HIF-1 signaling pathway
    111142072
   04068 FoxO signaling pathway
    111142072
   04151 PI3K-Akt signaling pathway
    111142072
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111142072
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142072
   05202 Transcriptional misregulation in cancer
    111142072
   05206 MicroRNAs in cancer
    111142072
   05203 Viral carcinogenesis
    111142072
  09162 Cancer: specific types
   05226 Gastric cancer
    111142072
   05220 Chronic myeloid leukemia
    111142072
   05215 Prostate cancer
    111142072
   05222 Small cell lung cancer
    111142072
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111142072
   04934 Cushing syndrome
    111142072
  09172 Infectious disease: viral
   05162 Measles
    111142072
   05169 Epstein-Barr virus infection
    111142072
   05165 Human papillomavirus infection
    111142072
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111142072
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111142072
NCBI-ProteinID: XP_022350729
UniProt: A0A2Y9IPY2
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHRRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGTRQAVPLMG
SQANSEDTHLVDQKTDTADNQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
GGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgggtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcagaaacctcttcggcccggtcaaccacgaagag
ctgacccgggacttggagaagcaccgcagagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggacgtcagcgggacccgccaggcggtgcctttaatgggg
tctcaggcaaactcagaggacacacacttggtagaccaaaagactgacacggcggacaac
cagacgggcttagcggagcagtgcactgggataaggaagcgaccggccacagacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccgaac
gggggttcagtggagcagacgcccaagaagccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system