KEGG   Enhydra lutris kenyoni (northern sea otter): 111142091
Entry
111142091         CDS       T05871                                 

Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05134  Legionellosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05164  Influenza A
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111142091
   04215 Apoptosis - multiple species
    111142091
   04115 p53 signaling pathway
    111142091
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142091
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111142091
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111142091
   05012 Parkinson disease
    111142091
   05014 Amyotrophic lateral sclerosis
    111142091
   05016 Huntington disease
    111142091
   05020 Prion disease
    111142091
   05022 Pathways of neurodegeneration - multiple diseases
    111142091
  09171 Infectious disease: bacterial
   05134 Legionellosis
    111142091
   05152 Tuberculosis
    111142091
  09172 Infectious disease: viral
   05161 Hepatitis B
    111142091
   05160 Hepatitis C
    111142091
   05164 Influenza A
    111142091
   05162 Measles
    111142091
   05168 Herpes simplex virus 1 infection
    111142091
   05169 Epstein-Barr virus infection
    111142091
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111142091
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like Nup160 CARD_2 Utp8 AAA_16 Hira ATPase_2 AAA_22
Other DBs
NCBI-GeneID: 111142091
NCBI-ProteinID: XP_022350750
UniProt: A0A2Y9IXT0
LinkDB
Position
Unknown
AA seq 1250 aa
MDAKARNCLLQHREALEKDIKTSYIMDRMINDGVLTVLEEEKVKNEPTQQQRAALLIKMI
LKKDNYSYISFYNALIHEGYKDLAALLQSGIPVISSSSGGKDSVGGITSYVKTVLCEGGV
PQRPVVFVTRKKLVNAIQQNLLKLNGEPGWVVIYGMAGCGKSVLAAESVRDHFFLDGCFP
GGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSL
LILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVSVESGLGKEKGLEILSLFV
NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSSY
DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFV
NKSLLFCDRNGKSFCYYLHDLQVDFLIEKNRNQLQNLHKKIITQFQKHYQPHTLSPDQED
CMYWYNFLAYHMGSANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCA
VCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDHGVLYLEWIN
KKNIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGVDKTLQVFKAETGEKLLEIKAHEDE
VLCCAFSTDDRFIATCSVDKKIKIWNSRTGELVRIYEEHSEQVNCCCFASNSQYLLLATA
SSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERK
SIDVKQFFLNSEEPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLAEIHTGH
HSTIQYCDFSPQNHLAVVALSQCCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLT
SSDDQTIRLWETKKVCKNSAIVLKQEIDVVFQENEVMVLAADNIKRLQLINGKTGQIDYL
TEAQVSCCCLSPYLQYIAFGGEDGAIEILELLNNRIFQSRIGHKKTVRHIQFTDDGKTLI
SSSDDSSIQVWNWQSEEYVFLQAHQETVKDFKLLKNSKLLSWSFDGTVKVWSIITGRIEK
DFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFDLLSPLHELRGHRGCVRCSVFSVDN
TLLATGDDNGEIRIWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDSKMLVSAGGY
LKWWNVVTGESSQTFYTNGTYLKKIHVSPDFKTYVTVDNLGILYILQMLE
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggacgcaaaagctcgaaactgtttgcttcaacatagagaagccctggaaaaggacatc
aaaacgtcctacatcatggatcgtatgattaatgatggagttttaacagtattggaggag
gaaaaagtaaaaaatgagcccactcaacagcagcgagcagctctgttaattaaaatgata
cttaaaaaagataattattcctacatatcattctacaatgctctaatacatgaagggtat
aaagatcttgctgcccttctccaaagtggcattcctgtcatctcttcttccagtggtggc
aaagattcagttggtggaataacttcatatgtaaagacagtcctgtgtgaaggtggagtg
ccacagaggccggttgtttttgttaccaggaagaagctggtgaatgcaattcagcagaac
ctgctcaaactgaatggtgaaccaggatgggttgtcatatatggaatggcaggttgtggg
aaatctgttttagctgcagaatctgttcgagatcattttttcttagatggttgtttccca
gggggtgtacactgggtttcagttgggaaacaggacaaatctggacttctgatgaaattg
cagaatctttgcacacggttggatcaagatgagagtttctctcagaggcttccgctcaat
attgaagaggctaaagaccgtcttcgcattctcatgctgcgcaaacacccaaggtctctg
ttgatcttggatgatgtttgggatccttgggtattaaaagcttttgacaatcagtgtcaa
attcttcttacaaccagggacaagagcgttacagattcagtaatgggtcctaaatatgta
gtctctgtggagagtggcttaggaaaagaaaaaggacttgaaattttatccctttttgtt
aatatgaagaaagcagatttgccagaacaagctcatagtattataaaggaatgtaaaggt
tctcctcttgtagtgtctttaattggtgcacttttacgtgattttcccaaccgttgggat
tactacctcaggcaacttcagaataagcaattcaagagaataaggaaatcttcatcttat
gattatgaggctctggatgaagccatgtctataagtgttgaaatgctcagagaggacatc
aaagattattacacagatctttccatccttcagaaggatgttaaggtgcctacaaaggtg
ttatgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtt
aataagtctctcttattttgtgatcggaatggaaaatcattttgttattatttacatgat
cttcaagtagatttccttatagagaagaatcgcaaccagcttcagaatctacataagaaa
ataatcactcagttccagaaacattaccagccacatactctttcaccagatcaggaggac
tgcatgtattggtacaattttctggcctaccacatgggtagtgccaatatgcacaaagaa
ctttgtgctttaatgttttccttggattggattaaagcaaaaactgaactcgtaggccct
gctcatctgattcatgaatttgtggaatacaggcatatattggatgaaaaggattgtgca
gtctgtgaaaatttccaggaatttttatctttaaatggacatcttcttggacgacagccg
tttcctaatattgtacaacttggtctttgtgaaccagaaacttcagaagtttatcagcaa
gctaagctgcaggccaagcaggaggtcgatcacggagtgctttatctggagtggataaac
aaaaaaaacatcaagaatctttcccgcttagttgtccgcccccatacagatgctgtttac
catgcttgcttttctgaggatggtcaaagaatagcttcttgtggagttgataaaacctta
caggtgttcaaagctgaaacaggagaaaaactgctagaaatcaaggctcatgaggatgaa
gtgctttgctgtgcattctctacagatgacaggtttatagcaacctgctcagtggataaa
aaaatcaagatctggaattctaggacgggggagctggtacgtatctatgaggagcactca
gagcaagtcaactgctgctgttttgccagcaacagtcagtaccttctcttagccaccgca
tcaagtgactgcttccttaaactctgggatttgaatcaaaaagaatgccgaaataccatg
tttggccacacaaattcagtcaatcactgcagattttcaccagatgataagcttttggct
agttgttcagctgatggaacattaaagctttgggatgtgaaatcagcaaacgagaggaaa
agcattgatgtgaagcagttcttcctaaattcagaggagcctcaagaggatatggaagtg
atagtgaaatgttgttcatggtctgctgatggtgctaggataatggtggcagcaaaaaat
aaaatctttctttttgacattcacaccagcggcttattggcagaaatccatacaggccat
cacagcaccatccagtattgtgacttctccccacaaaatcatttggcagtagtggctttg
tcccagtgctgtgtggagttgtggaatatggattcgtgtttaaaagtggctgattgcaga
ggacatttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgaca
tcttctgatgaccagacaatcaggctctgggagacaaaaaaagtatgtaagaactctgct
atagtgttaaagcaagaaatagatgttgtgtttcaagaaaatgaagtgatggttcttgca
gctgacaatataaaacgactgcagctcattaatggaaaaacaggtcagattgattatctg
actgaagctcaagttagttgctgttgcctaagtccgtatcttcagtacattgcatttgga
ggtgaagatggagccattgagattttagagctcctaaacaacagaatcttccaatccagg
attgggcacaagaaaactgtgcggcacatccagttcacagatgatgggaagactcttatt
tcaagctctgatgattcttcaattcaggtatggaattggcagtcagaagaatatgtcttt
ctacaagcccatcaggaaacagtgaaagactttaagctcttgaaaaattcaaaactgctt
tcctggtcatttgatggaacagtgaaggtatggagtattattactggaagaatagaaaaa
gattttgtctgtcaccaggatacagtactttcttgtgatatctctcctgatgctaccaag
ttttcatctacatctgctgacaagactgcaaagatttggagttttgaccttctctcccct
cttcatgaactgcggggccacagaggctgtgtgcgttgctctgtcttctctgtggacaat
accctattggcaactggagatgacaatggagaaatcaggatttggaacgtctcaaatggg
gaattgcttcatttgtgtgctccgatttcagtagaagaaggagctgctacccatggaggt
tgggtaactgacctttgcttttctccagatagcaaaatgcttgtctctgctggaggatat
cttaagtggtggaatgttgtcactggggaatcctcacagaccttctacacaaatggaacc
tatcttaagaaaatacacgtgtcccctgacttcaaaacatatgtgactgttgataatctt
ggtattttatatattttacagatgttagagtaa

DBGET integrated database retrieval system