KEGG   Enhydra lutris kenyoni (northern sea otter): 111142120
Entry
111142120         CDS       T05871                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04120  Ubiquitin mediated proteolysis
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04625  C-type lectin receptor signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111142120
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111142120
   04151 PI3K-Akt signaling pathway
    111142120
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111142120
  09143 Cell growth and death
   04110 Cell cycle
    111142120
   04115 p53 signaling pathway
    111142120
   04218 Cellular senescence
    111142120
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111142120
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111142120
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142120
   05202 Transcriptional misregulation in cancer
    111142120
   05206 MicroRNAs in cancer
    111142120
   05205 Proteoglycans in cancer
    111142120
   05203 Viral carcinogenesis
    111142120
  09162 Cancer: specific types
   05214 Glioma
    111142120
   05220 Chronic myeloid leukemia
    111142120
   05218 Melanoma
    111142120
   05219 Bladder cancer
    111142120
   05215 Prostate cancer
    111142120
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111142120
   05169 Epstein-Barr virus infection
    111142120
   05165 Human papillomavirus infection
    111142120
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111142120
   01522 Endocrine resistance
    111142120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111142120
   04121 Ubiquitin system [BR:elk04121]
    111142120
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111142120
Membrane trafficking [BR:elk04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    111142120
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    111142120
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 111142120
NCBI-ProteinID: XP_022350799
UniProt: A0A2Y9ITY4
LinkDB
Position
Unknown
AA seq 487 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVIVNQHESSDSGT
SVSENRCHLEGGSDQKDPVQELQEEKPSSSDLVSRPSTSSRRRTISETEEHSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEQSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAEESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKMPEKAKLENSTQVEEGFDVPDCKK
SSVSDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIYNSQEDVKEFEREETQDKEE
IVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQM
IVLTYFP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagcctttgcttttgaagttgttaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaagcaacagcatattgtgtattgttccaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtaatagtcaatcagcatgaatcatcagattcaggcaca
tctgtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggaccctgtgcaa
gagttgcaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagaacaattagtgagacagaagaacattcagatgaattacctggagaacggcag
agaaagcgccacaagtctgatagtatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcaacagggacgccatca
aatccggatcttgatgctggtgtaagtgaacaatcaggtgattggttggatcaggattca
gtctcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattatagt
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagtaactgtg
tatcaggcagaggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcgtgcagtgaaatgaatcctcctcttccacctcattgcaac
agatgttgggcccttcgtgagaattggcttcctgaagataaagggaaaatgcctgagaaa
gccaaactagaaaactcaacacaagtagaagagggctttgatgtccctgattgtaaaaaa
tcttcagtgagtgattccagagaatcgtgtgctgaggaaaatgatgataaaatcacacaa
gcctcccaatcccaagaaagtgaggactattctcagccatcaacttctaatagcatcatt
tataacagccaagaagatgtcaaagagtttgagagggaagaaacacaagacaaagaagaa
attgtggaatctagtttcccccttaatgccattgaaccttgtgtgatttgccaaggtcga
cctaaaaacggttgtattgttcatggcaaaacaggacatcttatggcatgctttacgtgt
gcaaagaagctaaagaaaaggaataagccctgtcccgtatgtagacaaccaattcaaatg
attgtgctaacttatttcccttaa

DBGET integrated database retrieval system