KEGG   Enhydra lutris kenyoni (northern sea otter): 111142191
Entry
111142191         CDS       T05871                                 

Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04072  Phospholipase D signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04640  Hematopoietic cell lineage
elk04916  Melanogenesis
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111142191
   04014 Ras signaling pathway
    111142191
   04015 Rap1 signaling pathway
    111142191
   04072 Phospholipase D signaling pathway
    111142191
   04151 PI3K-Akt signaling pathway
    111142191
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111142191
  09152 Endocrine system
   04916 Melanogenesis
    111142191
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142191
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111142191
Cytokines and growth factors [BR:elk04052]
 Growth factors
  Growth factors (RTK binding)
   111142191
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 111142191
NCBI-ProteinID: XP_022350911
UniProt: A0A2Y9IRK2
LinkDB
Position
Unknown
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICRNRVTDDVKDVTKLVANLPKDYKIALNYVPG
MDVLPSHCWIRVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSFKSPEPRHFTPEDFFRIFNRSIDALKDLEIVASKTSECVLPSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKAANPLGDSNLQWAAMALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactactcctatttaat
cctctggtgaaaactaaagggatctgcaggaaccgtgtgaccgatgatgtaaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaactatgtccccggg
atggatgttttgcctagtcattgttggataagagtgatggtggaacagttgtcagtcagc
ttaactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtggacgaccttgtggagtgcatggaggaacactcattt
gagaatgtaaaaaaatcatttaagagcccagaacccaggcattttacccctgaagatttc
ttcagaatttttaacagatccattgatgccctcaaggacttggagatagtggcatctaaa
actagtgaatgtgtgcttccttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggccgcaaacccccttggagactccaacttgcagtgggcggccatggca
ttgccggcattcttctctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatctcacaaggacagttgaaaatatacagattaatgaagaggataatgaa
ataagtatgttgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system