KEGG   Enhydra lutris kenyoni (northern sea otter): 111142384
Entry
111142384         CDS       T05871                                 

Definition
(RefSeq) ran-specific GTPase-activating protein isoform X1
  KO
K15306  Ran-binding protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111142384
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111142384
SSDB
Motif
Pfam: Ran_BP1 WH1 DUF1681
Other DBs
NCBI-GeneID: 111142384
NCBI-ProteinID: XP_022351121
UniProt: A0A2Y9IS42
LinkDB
Position
Unknown
AA seq 209 aa
MAAAKDTHEDHDTSTENADESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNNDAEKV
TEKLEALSVKEESKESEDAESKAGAEEEQ
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcggccgccaaggacacccatgaggaccatgatacctccactgagaatgccgacgag
tccaaccacgacccccagtttgagcctatagtttctcttcctgagcaagaaattaaaacg
ctggaagaagatgaagaagagctttttaaaatgcgggcaaagctattccgattcgcttca
gagaatgatctcccagagtggaaggaacgaggcactggtgacgttaagcttctgaagcat
aaggaaaaagggaccatccgcctcctcatgaggagggacaagaccctgaagatatgcgcc
aaccactacatcacaccgatgatggaactgaagccgaatgcgggcagcgaccgtgcctgg
gtctggaacacccacgctgactttgccgacgagtgccccaagccagagctgctggccatc
cgcttcctaaatgctgaaaatgcacagaaattcaaaacaaagtttgaagaatgcaggaaa
gagatcgaggagagagaaaagaaagcagggtcaggcaaaaacaatgatgccgagaaggtg
actgagaagctagaagctctctccgtgaaggaggagagcaaggagtcggaagacgccgag
agcaaggctggagcggaggaggagcaataa

DBGET integrated database retrieval system