KEGG   Enhydra lutris kenyoni (northern sea otter): 111142395
Entry
111142395         CDS       T05871                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04144  Endocytosis
elk04218  Cellular senescence
elk04350  TGF-beta signaling pathway
elk04371  Apelin signaling pathway
elk04390  Hippo signaling pathway
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04659  Th17 cell differentiation
elk04926  Relaxin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05142  Chagas disease
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111142395
   04390 Hippo signaling pathway
    111142395
   04371 Apelin signaling pathway
    111142395
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111142395
  09143 Cell growth and death
   04110 Cell cycle
    111142395
   04218 Cellular senescence
    111142395
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111142395
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111142395
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111142395
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142395
   05205 Proteoglycans in cancer
    111142395
  09162 Cancer: specific types
   05210 Colorectal cancer
    111142395
   05212 Pancreatic cancer
    111142395
   05225 Hepatocellular carcinoma
    111142395
   05226 Gastric cancer
    111142395
  09163 Immune disease
   05321 Inflammatory bowel disease
    111142395
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111142395
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111142395
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111142395
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 111142395
NCBI-ProteinID: XP_022351160
UniProt: A0A2Y9IZB1
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccggttgtgaaaaggctgctgggatggaagaaa
tcagctggtggatctggaggagcaggcggaggagagcagaatggacaagaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctctggatggccgtctacaagtgtcccatcgg
aaaggactgccacatgtgatatattgccgattgtggcgctggcctgaccttcacagtcac
catgagctcaaagcaatcgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttctgcctcccgtactggtg
ccgcggcacactgagatcctaacagagctgcctcctctggacgattatacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattacatcccagaaacg
ccacctcctggatatatcagtgaggatggagagacaagcgatcagcagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccccgttaatcatagt
ttggatttgcagccagttacttactcagaacctgcattttggtgttcaatagcctattat
gaattaaaccagagggttggcgagaccttccacgcatcacagccctcactcactgtcgac
ggtttcacagatccatccaattcagagaggttctgcctagggttgctctccaacgtcaac
cgaaacgcgactgtagaaatgacaagaagacatataggaagaggagtgcgcttatattac
atcggtggagaagtttttgccgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaatcagagatacggctggcaccctgcaaccgtgtgtaagatcccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtccgttaatcag
ggttttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcggaataccgaaggcagacggtaacgagcactccttgctggattgagctt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcgagcatgtcataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153179
Entry
111153179         CDS       T05871                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04144  Endocytosis
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04350  TGF-beta signaling pathway
elk04371  Apelin signaling pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04659  Th17 cell differentiation
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05161  Hepatitis B
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05220  Chronic myeloid leukemia
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111153179
   04350 TGF-beta signaling pathway
    111153179
   04390 Hippo signaling pathway
    111153179
   04371 Apelin signaling pathway
    111153179
   04068 FoxO signaling pathway
    111153179
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111153179
  09143 Cell growth and death
   04110 Cell cycle
    111153179
   04218 Cellular senescence
    111153179
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111153179
   04550 Signaling pathways regulating pluripotency of stem cells
    111153179
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111153179
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111153179
  09162 Cancer: specific types
   05210 Colorectal cancer
    111153179
   05212 Pancreatic cancer
    111153179
   05225 Hepatocellular carcinoma
    111153179
   05226 Gastric cancer
    111153179
   05220 Chronic myeloid leukemia
    111153179
  09163 Immune disease
   05321 Inflammatory bowel disease
    111153179
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111153179
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111153179
   05161 Hepatitis B
    111153179
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 111153179
NCBI-ProteinID: XP_022367731
UniProt: A0A2Y9K3C9
LinkDB
Position
Unknown
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgaactggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccgcctgcaggtgtcccatcgg
aaggggctcccccatgtcatctactgccgcctgtggcgatggcccgacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggatgaggtc
tgcgtgaatccctaccactatcagagggtagagaccccagttctacctcctgtgctggtc
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cccgagaacacgaacttccctgcgggcatcgagccccagagcaatattccagaaacccca
ccccctggctacctgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gatgcaggttctccaaacctatccccgaatccgatgtccccagcgcacaataatttggac
ctgcagcctgtcacctactgcgagccggccttctggtgctccatctcctactatgaactg
aaccagcgcgttggggaaacattccacgcctcgcagccttccatgaccgtggatggcttc
accgacccctccaactcggagcgcttctgcttggggctgctctccaatgtcaacaggaac
gcggccgtggagctcacgcggaggcacatcgggcgaggcgtgcggctgtactacatcgga
ggggaggtcttcgcagagtgcctcagcgacagcgccatcttcgtccagtcgcccaactgt
aaccagcgctacggctggcacccggccaccgtctgcaagatcccgccggggtgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggctcagtccgtcaaccagggcttc
gaggcggtctaccagttgacccggatgtgcaccatccgcatgagcttcgtcaagggctgg
ggagcggaatacaggagacaaaccgtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcactcagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system