KEGG   Enhydra lutris kenyoni (northern sea otter): 111142425
Entry
111142425         CDS       T05871                                 

Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04120  Ubiquitin mediated proteolysis
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111142425
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111142425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111142425
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     111142425
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111142425
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 111142425
NCBI-ProteinID: XP_022351197
UniProt: A0A2Y9IR54
LinkDB
Position
Unknown
AA seq 621 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFNLDGSSSPVEPDLAVAGIHALPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGTWCPMRPKKEAMKVSSQPCTKIESSSVLTKPCSVTVANETSKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSS
RSETGVITSSGSNIPDIISLD
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggcggatttcgaggagttgaggaatatggtttctagctttagggtttctgaactgcaa
gtgttactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gcgttgcatttactgaagagcggctgcagccctgcggttcagatcaaaatccgagaattg
tacagacgccggtacccacggactctcgaaggactctctgatttatccaccatcaaatct
tcggttttcaatttggatggtagctcatcacctgtagaacctgacttggccgtggctgga
atccacgcactgccttccacctcagttacaccgcactcaccgtcctctcctgtgggttct
gtgctgcttcaagatacgaagcccacgtttgagatgcagcagccatctcccccaatccct
cctgtccatcctgatgtgcagttaaaaaacttgcccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcgatttcaagagaagttttttatt
tttgctctgacacctcagcaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaggttcagctgagactttgcctggcagagacaagttgt
cctcaagaagacaactatcccaatagtctatgtataaaagtaaatgggaagctgtttcct
ttgcctggttatgcaccaccacctaaaaatgggattgaacagaagcgccctggacgtcct
ttgaatattacatctttagttaggttatcctcagctgtgccaaaccaaatttccatttct
tgggcatcagaaatcggaaagaattactccatgtctgtatatcttgtacgacagctcaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagcctt
cgggtatccttgatgtgccctttagggaaaatgaggttgacaatcccgtgccgcgcagtg
acttgtacacatctgcagtgttttgacgctgctctttatctgcaaatgaatgagaagaag
cccacctggatctgtcccgtgtgtgataaaaaagctgcctatgaaagtctcattttagat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaagag
gatggcacttggtgtccaatgagaccgaagaaagaagctatgaaagtgtccagccagcca
tgtacaaaaatagaaagttcaagtgtcctcactaagccatgttcagtgactgtagccaat
gagacaagcaagaagaaagtggatgttattgacctaacaatagaaagctcttctgatgaa
gaggaagacccacctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccacacgcca
atatcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagtactgtcctcctatgtttttggatagtctcacctcacccctaacagcaagcagt
acgtctgtcaccaccaccagcccccatgaaagcagtactcatgttagttcctccagcagc
aggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctcattg
gactaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153180
Entry
111153180         CDS       T05871                                 

Definition
(RefSeq) E3 SUMO-protein ligase PIAS1 isoform X1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04120  Ubiquitin mediated proteolysis
elk04630  JAK-STAT signaling pathway
elk05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111153180
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111153180
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    111153180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111153180
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:elk04812]
    111153180
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     111153180
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111153180
Cytoskeleton proteins [BR:elk04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    111153180
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 111153180
NCBI-ProteinID: XP_022367732
UniProt: A0A2Y9K3D1
LinkDB
Position
Unknown
AA seq 657 aa
MNEYLTVALKQGNEQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQ
MKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLSYDGHPASSPLLPVSLL
GPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALT
PQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYL
PPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLL
QRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHL
QCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWA
PMRSKKEVQEVSASYNGVDGCLSSTLEHQVTSHHQSSNKNKKVEVIDLTIDSSSDEEEEE
PSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMT
PMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLS
AGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVANRSSTDTASIFGIIPDIISLD
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgaatgaatacctgacagttgcattgaaacagggcaatgagcaaatggttatgagcctt
agagtttctgaactccaagtactgttgggctacgctgggagaaacaagcacggacgcaaa
cacgaacttctcacaaaagccctgcatttgctaaaggctggctgcagtcctgctgtacaa
atgaaaattaaagaactctataggcggaggttcccccagaaaatcatgacgcctgcggac
ttgtccatccccaatgttcattcaagtcctatgccagcaactttgtctccatctaccatt
ccacaactctcttacgatggtcaccctgcatcatcaccgttactccctgtttctcttctg
ggacctaaacatgaactggaactcccacatcttacatcagctcttcacccagtccatccg
gatataaaacttcaaaaattaccattttatgatttactggatgaactgataaaacccacc
agtctagcatcagacaacagtcagcgctttcgagaaacctgttttgcatttgcattgaca
ccacaacaagtgcagcagatcagtagttccatggatatttctgggaccaaatgtgacttc
acagtgcaggtccagttaaggttttgtttatcagaaaccagttgtccacaagaagatcac
ttcccacccaatctttgtgtgaaagtgaatacaaaaccttgcagccttccgggttatctt
ccacctacaaaaaatggtgtggaaccaaagcgacccagccgaccaatcaatatcacctca
cttgtccgattgtccacaacagtaccaaacaccattgttgtttcttggactgcagaaatt
ggaagaaactattccatggcagtgtatcttgtaaaacagttgtcctcaacagtacttctt
cagaggttacgagcaaagggaataaggaatccggatcattctagagctttaattaaagag
aaattgaccgcggatccagacagtgaaatagctacaaccagcctaagggtttctctccta
tgtccacttggtaaaatgcggctgacaattccatgccgggccctgacatgttctcatctg
cagtgttttgatgcaactctctatattcagatgaatgagaaaaaaccaacctgggtttgt
cctgtctgtgataagaaggccccatatgagcaccttatcattgatggcttgtttatggaa
atcctaaagtactgtacagactgcgatgagatacagtttaaggaggatggctcttgggca
cctatgagatcaaaaaaggaagtacaggaagtctctgcctcttacaatggagttgatgga
tgcttgagctccacattggagcatcaggtgacttctcaccaccagtcctcaaataaaaat
aagaaagtagaggtgattgacttaaccatagacagttcatctgatgaagaggaggaggag
ccatctgccaagaggacctgtccttccctgtctcccacatcaccactaaataataaaggc
atattaagtcttccacatcaagcgtctccagtgtcccgcaccccaagcctccctgctgta
gacacaagctacattaatacatccctcatccaagactacaggcatcctttccacatgaca
cccatgccttatgacctacaaggattagatttctttcctttcttatcaggagacaatcag
cattataacacgtccctcctggctgccgccgccgcagcagtgtcagatgatcaagacctc
ttacactcgtctcggtttttcccgtatacctcctcgcagatgtttctcgatcagttaagt
gcaggaggcagtacttctctgccaaccaccaatggaagcagtagtggcagtaacagcagc
ctcgtgtcctccaacagcctgcgggagagccatagccacaccgttgcaaacaggagcagc
acggacacagcatccatcttcggcatcataccagacattatttcattggactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161688
Entry
111161688         CDS       T05871                                 

Definition
(RefSeq) E3 SUMO-protein ligase PIAS4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04064  NF-kappa B signaling pathway
elk04120  Ubiquitin mediated proteolysis
elk04630  JAK-STAT signaling pathway
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111161688
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111161688
   04064 NF-kappa B signaling pathway
    111161688
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111161688
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111161688
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111161688
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111161688
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP CENP-B_dimeris
Other DBs
NCBI-GeneID: 111161688
NCBI-ProteinID: XP_022381206
UniProt: A0A2Y9L5J0
LinkDB
Position
Unknown
AA seq 512 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSSEPVPQPHRPLDPLTMHSTYDRAGTVPRTPLSGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNSEKLQESPCIFALTPRQVELIRNSR
ELQPGIKAVQVVLRICYSDTSSPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLARQLTSAELLQGLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWTCPVCDKPAPYDQLVIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQCP
ILVLGPSDANGLLSAPNVNGGGSGGALGGAGGGAAGGVENGKPGADVVDLTLDSSSSSEE
EEDEEEEDEDEDEEGPRPKRRCPFQKGLVSAC
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagtttccgagtctccgatctt
cagatgctcctgggttttgttggccggagtaagagtggacttaaacacgaacttgtcacc
cgggccctccagctggtccagtttgactgtagccctgagctgttcaagaagatcaaggag
ctgtacgagacacgctacgccaagaagagctcagagcctgtcccccagccccaccggccc
ctggaccccctgaccatgcactcaacttacgaccgggctggcacggtgcccaggactccc
ctctcgggccccaacattgactaccctgtgctctacgggaagtacttgaatggacttgga
cgcttgcccgccaagaccctcaagccagaagtgcgtctggtgaaactgcccttcttcaac
atgctggacgagttgctgaagcccacagagctggtcccacagaatagcgagaagctgcag
gagagcccgtgcatctttgcgctaacgccgaggcaagtggagctgatcaggaactccaga
gaactgcagcccgggatcaaggccgtgcaggtcgtcctcagaatttgctactcagacacc
agcagccctcaggaggaccagtacccacccaacatcgccgtaaaggtcaaccacagctat
tgctcagtcccgggctactacccctccaataagccgggagtggaacccaaaaggccctgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcaccgtg
acctgggggaactacggcaagagttactccgtggccttgtacttggcgcggcagctgacc
tctgcggagctgctgcagggcttgaaaaccatcggggtcaagcacccggagctgtgcaag
gcgctggtcaaagagaagctgcgcctggaccccgacagcgagatcgccaccacgggcgtg
cgggtctccctcatctgcccgctggtgaagatgcggctgtcggtgccctgccgcgccgag
acctgcgcgcacctgcagtgcttcgacgccgtcttctacctgcagatgaacgagaagaag
cccacgtggacgtgcccggtgtgcgacaagccggccccctacgaccagctcgtcatcgat
gggctcctctccaagatcctgagtgagtgcgaggacgcggacgagatcgagtacctggtg
gacggctcgtggtgcccgatccgcgccgagaaggagcgcagctgcagtccccagtgtccc
attctcgtgctgggcccctcggacgccaatgggctcctgtccgcccccaacgtcaatggc
ggtggcagcggcggcgcgctggggggcgccggcggcggcgcggcaggcggtgtggagaac
gggaagccgggagccgacgtggtggacctcacgctggacagctcgtcgtcctcggaggag
gaggaggatgaggaagaggaggacgaggacgaggacgaggagggcccccggcccaagcga
cgctgcccctttcagaagggcctggtgtcggcctgctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162013
Entry
111162013         CDS       T05871                                 

Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04120  Ubiquitin mediated proteolysis
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111162013
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111162013
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     111162013
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111162013
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 111162013
NCBI-ProteinID: XP_022381870
UniProt: A0A2Y9LJK1
LinkDB
Position
Unknown
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYAELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHRSTTPAPPPGRVSSIVAPG
GGLREGPGGPLSSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcatatggtgatgagcttccgggtgtctgagcttcag
gtgctgctcggctttgctggccgtaacaagagtggacggaagcacgagctcctggccaag
gccctgcacctcctcaagtccagctgtgcccccagtgtccagatgaagatcaaagagctt
taccgccgacgctttccccggaagactctggggccctctgatctctcccttctctctctg
ccccctggaacccctccagttggctccccaggtcctctagctcccattcccccggccctc
ttggcccctggcaccctgctgggccccaagcgtgaagtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccgttgcccttctatgaagtctatgcggag
ctcatccggcccaccaccctcgcgtccacttctagccagcggttcgaagaggcacacttt
acctttgccctcacgccccaacaggtgcagcagattctcacgtccagagaggttctccca
ggagccaaatgtgactatactatacaagtgcagctaaggttctgtctctgtgagaccagc
tgtccccaggaggattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttccccctaccaagaatggggctgagcccaagaggcctagccgc
cccatcaacatcacacctctggctcgtctctctgccactgttcccaacaccatcgtggtc
aactggtcatctgagtttggacggaactactccttgtctgtgtacctggtgaggcagctg
actgcggggacccttctacagaaactcagagcaaagggtatccggaacccagaccactct
cgggcactgatcaaggagaaattgaccgctgacccggacagtgaggtggccactacgagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgacagtcccttgtcgggcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagccaacatggacatgtcctgtttgtgacaagaaggctccttatgaatctcttatcatt
gatggcttattcatggagatacttaattcctgttcggattgtgatgagatccagttcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaagagggcaatccatcagag
aataagaagaaggttgaagttattgacttgacaatagagagttcgtcagatgaggaggac
ctgcccccgaccaaaaagcactgtcctgtcacctcagctgccatcccagcgcttcctgga
agcaaaggagtcctgacatctggtcaccagccatcttcggtgctacggagccctgctatg
ggcacactgggcggggatttcctatccagtctcccactacatgagtacccacctgctttc
ccactgggggctgatatccaaggtttagatttgttttctttcctccagactgaaagtcag
cattatggtccctccgtcatcacctcgctagatgaacaggatgcccttggccacttcttc
cagtaccgagggaccccttcccacttcctgggcccactggcccccacattggggagctct
caccgcagcaccactccagcaccccctcctggccgtgtcagtagcattgtggcccctggg
gggggcttgagggaggggcctggaggacccctatcctcaggtccctctttgactggctgc
cggtcagacatcatttccctggactga

DBGET integrated database retrieval system