KEGG   Enhydra lutris kenyoni (northern sea otter): 111142429
Entry
111142429         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X1
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111142429
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111142429
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111142429
Protein phosphatases and associated proteins [BR:elk01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111142429
SSDB
Motif
Pfam: Y_phosphatase DSPc CHASE3 LAP1C Y_phosphatase3
Other DBs
NCBI-GeneID: 111142429
NCBI-ProteinID: XP_022351255
UniProt: A0A2Y9IZL3
LinkDB
Position
Unknown
AA seq 416 aa
MSATVEREFEELDAQNRWQQLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTGCHFWLMVWQQKTKAVVMLNRVVEKES
VKCAQYWPTKDDREMLFKETGFSVKFLSEDVKSYYTVHLLQLENINSGETRTISHFHYTT
WPDFGVPESPASFLNFLFKVRESGSLNPEHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG
DDINIKQLLLNMRKYRMGLIQTPDQLRFSYMTIIEGGKFIKGDSNIQKRWKELSKEDLCP
AFDHSPTKIMTEKYNGNRIGLEEEKLTGDRYTGLSSKMQGTAEENSESVLRKRIREDRKA
NTAQKVQQMKQRLNETERKRKRWLYWQPILTKMGFVSFILVGAFVGWTLLFQQNVL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtctgccaccgtcgagcgggagtttgaggagttggatgctcagaatcgctggcagcag
ctgtatttggaaattcgcaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaag
ctgcaaaatgctgaaaatgattatataaatgccagtttagttgatatagaagaggcgcaa
aggagttacatcttaacacagggtccacttcctaatacaggttgccatttctggctcatg
gtttggcagcaaaaaaccaaagcagttgtcatgctaaaccgagttgtggagaaggaatcg
gttaaatgtgcacagtactggccgacaaaagatgatcgagagatgctgtttaaagaaaca
ggattcagtgtgaagttcttgtcagaagatgtgaagtcatattatacagtacatctactg
cagttagaaaatatcaatagtggtgaaaccagaacaatatctcactttcattatactacc
tggccagattttggagtccctgaatcaccagcttcatttctcaatttcttatttaaagtg
agagagtctggttccttgaatcctgaacacgggcctgcagtgatccactgcagcgcgggc
attgggcggtcaggcaccttttctctagtagatacctgtcttgttctgatggaaaaagga
gatgatattaacattaaacaactgttactgaatatgaggaaatatcgaatgggacttatt
cagacaccagatcaactcagattttcatatatgactataatagaaggaggaaaatttata
aagggagattcaaatatacagaaacggtggaaagaactttctaaggaagacttatgtcct
gcttttgatcattcaccaaccaaaataatgactgaaaaatacaatggtaataggataggc
ctagaagaagaaaaactgacaggtgacagatacacaggactatcctctaaaatgcagggt
actgcggaggagaacagcgagagtgttctacggaaacgaattcgagaagacagaaaagct
aacacggcccagaaggtgcagcagatgaaacagaggctaaatgagactgaacgaaaaagg
aaaaggtggttatattggcaacctattctcactaagatggggtttgtgtcattcattttg
gtgggtgcttttgttggctggacactgttgtttcagcagaatgtcctataa

DBGET integrated database retrieval system