KEGG   Enhydra lutris kenyoni (northern sea otter): 111142438
Entry
111142438         CDS       T05871                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04310  Wnt signaling pathway
elk04350  TGF-beta signaling pathway
elk04371  Apelin signaling pathway
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04659  Th17 cell differentiation
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05161  Hepatitis B
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05220  Chronic myeloid leukemia
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111142438
   04350 TGF-beta signaling pathway
    111142438
   04390 Hippo signaling pathway
    111142438
   04371 Apelin signaling pathway
    111142438
   04068 FoxO signaling pathway
    111142438
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111142438
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111142438
   04550 Signaling pathways regulating pluripotency of stem cells
    111142438
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111142438
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142438
  09162 Cancer: specific types
   05210 Colorectal cancer
    111142438
   05212 Pancreatic cancer
    111142438
   05225 Hepatocellular carcinoma
    111142438
   05226 Gastric cancer
    111142438
   05220 Chronic myeloid leukemia
    111142438
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111142438
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111142438
   05161 Hepatitis B
    111142438
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 111142438
NCBI-ProteinID: XP_022351276
UniProt: A0A2Y9ISJ5
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRSAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccgacaagtaacgatgcctgtctgagcattgtc
catagtttgatgtgccatagacaaggcggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaagagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagaggacattggatggg
aggcttcaggtggcaggtcggaagggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactcaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactacgaacgagttgtatcacctgga
attgatctctcaggattaacactgcaaagtaatgctccaccaagtatgttggtgaaggat
gagtatgttcatgactttgagggacagccatcattatcaactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcctcaacggagacgtacagcaccccagctctg
ttagctccgtctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcgggcagccatagtgaaggactgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggagcgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgttcacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcagtctttgtgcagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatacataaaggtctttgacttg
cgccagtgtcaccggcagatgcagcagcaggcggccaccgcgcaggctgccgccgccgcc
caggcagcggctgtggcgggaaacatccctggccccgggtcggtagggggaatagctcca
gccatcagtttgtcagcggctgccggcattggcgttgatgaccttcgtcgcttgtgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacaaagcatcaaagaa
acgccttgctggattgagattcacttacaccgggccctccagctcttagatgaagtgctt
cacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system