KEGG   Enhydra lutris kenyoni (northern sea otter): 111142686
Entry
111142686         CDS       T05871                                 

Definition
(RefSeq) ralA-binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk05200  Pathways in cancer
elk05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111142686
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142686
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111142686
Membrane trafficking [BR:elk04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    111142686
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 111142686
NCBI-ProteinID: XP_022351691
UniProt: A0A2Y9IT41
LinkDB
Position
Unknown
AA seq 655 aa
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDSLHEPPDI
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
MDVPNLKPIFGVPLTDAAERTMMYDGIRLPAVFRECVDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRSTESEKV
QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVILKPVTKPLRWSNMATMPTLPETQENIKEEIRRQEFLLNCLHRDLQAGV
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
DSESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQLQRAK
PELQVQDEAEPERRGGAGQPPRDSAAETKAAKEQPKAGKEQAKPSPSRDRKETPI
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgactgagtgcttcctgccccccaccagcagccccagtgaacaccgcagggtggagcat
ggcagtggtcttacccgaacccccagctctgaggagatcagccctactaagttccctgga
ttgtaccgcaccggcgagccctcgcctccccatgacagcctccatgaacctcctgacata
gtgtctgatgatgagaaagaccatgggaagaaaaaaggaaaatttaagaaaaaagaaaaa
aggactgaaggctatgctgcctttcaggaagatagctctggagatgaagctgaaagtcct
tccaaaatgaaaaggtccaagggaatccatgtttttaagaagcccagcttttctaaaaag
aaagagaaggattttaaaataaaagagaaacccaaagaggaaaaacataaagaagaaaag
cacaaagaagagaaacataaagagaagaagtcgaaagacttgacagcagctgatgttgtt
aaacagtggaaggaaaagaagaaaaagaagaagccaattcaggagccagaggtgcctcag
atggatgtccccaatctcaagcccattttcggagttcccctgaccgatgcagctgagcgg
accatgatgtacgacggcatccggctgccggcggtgttccgcgagtgcgtggattacgtg
gagaagtacggcatgaagtgtgaaggcatctacagagtgtcaggaattaaatcaaaggtg
gatgagctgaaagcggcctatgacagagaggagtctcccaatttggaagagtatgaacct
aacactgtagccagtttgttgaagcagtatttgcgagaccttccggagaatctgcttacc
aaagagctgatgcctcgctttgaggaggcatgtggaaggagcacagagagcgagaaggtg
caggaattccagcgcttgctcaaagaactgccagaatgtaactatctcctgatttcttgg
ctgatcgtgcacatggaccatgttatcgcaaaggaactggaaacaaaaatgaatatacag
aacatttctatagtgctcagcccaacggttcagattagcaatcgtgtcctatatgtgttt
ttcacacatgtgcaagagctctttggaaatgtgatactaaagccagtgacaaaacctctt
cgatggtctaacatggccactatgcccacactgccagagacccaggagaacatcaaggag
gagatcagaagacaggagtttcttttgaattgtttacatcgagatctgcaggctggggta
aaggatttatctaaagaagaaagattatgggaagtacaaagaattttgacagccctcaaa
aggaaactgagagaagctaaaagacaggagtgcgaaaccaagattgcgcaagagattgcc
agtctttcaaaagaggatgtttccaaagaagaaatgaatgaaaatgaggaagtcataaat
attctccttgctcaggagaatgagatcctgactgaacaggaggagcttctagctatggag
cagtttctgcgccgacagattgcctcagaaaaagaagagattgaacgcctcagagccgag
attgctgaaattcagagccgtcagcagcatggccgcagtgagaccgaggagtactcctcg
gacagtgagagtgagagtgaggacgaagaggagcttcagatcatcctggaggacttacag
aggcagaatgaagaactagaaataaagaacaatcatttgaatcaagcgattcacgaggag
cgggaggccatcatcgaactgcgggtgcagctgcgcctgctccagctgcagcgagccaag
cccgaactgcaggtgcaggacgaggccgagcccgagaggcgtggcggtgccggacagccg
cccagagacagcgccgcggagacgaaggcagcaaaggagcagccaaaggcaggcaaggag
caggccaagccgtccccgagcagagacaggaaggagacgcccatctga

DBGET integrated database retrieval system