KEGG   Enhydra lutris kenyoni (northern sea otter): 111142840
Entry
111142840         CDS       T05871                                 

Definition
(RefSeq) metalloreductase STEAP3 isoform X1
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
elk04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    111142840
   04115 p53 signaling pathway
    111142840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111142840
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     111142840
Membrane trafficking [BR:elk04131]
 Exocytosis
  Others
   Others
    111142840
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct Shikimate_DH NAD_binding_2 2-Hacid_dh_C IlvN
Other DBs
NCBI-GeneID: 111142840
NCBI-ProteinID: XP_022351879
UniProt: A0A2Y9IWY8
LinkDB
Position
Unknown
AA seq 522 aa
MAAEASGAQDPSIPGCGESPGMKDRTLNSPSATQVSGEMDKPLISRRLVDSDGSLAETPS
EAPKVGILGSGDFARSLVTRLVGSGFSVVVGSRNPKRTAGLFPSAAQVTFQAEAVDSPDV
IFVAMFREHYSSLCGLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAF
NVISAWTLQSGPRDGNRQVPICSDHPEAKRAVSEMVQAMGFMPVDMGSLVSAREVEAMPL
RLLPGWKVPALLALGLFIFFYVYNFVRDVLQPYVRDGKSKFYKLPVSVVNTTLPCVAYVL
LSLVYLPGVLAAALQLRRGTKYRRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLG
RVNRYEVVNLAIKQVLANKSHLWIEEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSL
NWREFSFVQSTLGFVALVLSTLHTLTYGWTRAFEDSHYKFYLPPTFTLTLLVPCVVILAK
GLFLLPYFRRKLSRIRRGWEKDGGVKFTLTMDHTLAQKTSHV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcggccgaggcctcgggggcacaggatccctccatcccaggctgtggagagtcccct
ggcatgaaggacaggacattgaactcgccatcagccacccaagtgtcaggagagatggat
aagccactgatcagccgccgcctggtggacagtgatgggagccttgccgagacccccagt
gaggcccccaaagtgggcatcctgggcagcggggactttgcccgctccctggtcacacgc
ctggtgggctctggctttagcgtggtggtggggagccgcaaccccaaacgcacggctggg
ctgttcccctcagcagcacaagtgactttccaggcggaggcagtggactcccctgacgtc
atcttcgtggccatgttccgggagcactactcctctctgtgtggcctcagcgaccagctg
gctggcaagatcctcgtggacgtgagcaaccccacagagcaggagcacctccagcaccgc
gaatccaatgcagagtacctggcttccctcttccccacgtgcacagtggtcaaggccttc
aatgtcatctctgcctggaccctgcagtctggcccaagggatgggaacagacaggtgccc
atctgcagtgaccacccggaagccaagcgggcggtctcggagatggtgcaggccatgggc
ttcatgcctgtggacatggggtccctggtctccgcccgggaggtggaagccatgcccctg
cgccttctcccaggctggaaggtgcccgccctcctggccctggggctcttcatcttcttc
tacgtctacaactttgtccgggacgtcctgcagccctatgtgcgggatggcaagagcaag
ttctacaagctgcccgtgtccgtggtcaacacgacgctgccgtgcgtggcctatgtgctg
ctgtccctggtgtacctgcccggcgtgctggcggccgccctgcagctgcgccgtggcacc
aagtaccgccgcttcccggactggctggaccactggctgcagcaccgcaagcagataggc
ctgctgagtttcttctgcgccgcgctgcacgcgctctacagcttctgcctgcccctgggc
cgcgtcaaccgctacgaggtggtcaacctcgccatcaaacaggtcttggccaacaagagt
catctgtggatcgaggaagaggtctggcggatggagatctacctctccctgggagtgctg
gcccttggtacactgtctctgctggctgtcacgtcactgccctccattgcaaactcgctc
aactggagggagttcagctttgttcagtccactctgggctttgtggccctggtgctgagc
accctgcacacactcacctacggctggacccgcgccttcgaagatagccattacaagttc
tacctgcctcccacgttcacgctcacgctgctggtgccctgcgtcgtgatcctggccaaa
ggcctcttcctgctcccctacttccgccgcaagctctccagaatccggaggggctgggag
aaggatggtggcgtcaagtttactctgacaatggaccacaccttggcccagaagacgagc
cacgtgtga

DBGET integrated database retrieval system