KEGG   Enhydra lutris kenyoni (northern sea otter): 111142881
Entry
111142881         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04621  NOD-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05140  Leishmaniasis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05212  Pancreatic cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111142881
   04151 PI3K-Akt signaling pathway
    111142881
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111142881
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111142881
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111142881
   04658 Th1 and Th2 cell differentiation
    111142881
   04659 Th17 cell differentiation
    111142881
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111142881
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142881
   05203 Viral carcinogenesis
    111142881
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111142881
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111142881
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111142881
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111142881
   05161 Hepatitis B
    111142881
   05160 Hepatitis C
    111142881
   05171 Coronavirus disease - COVID-19
    111142881
   05164 Influenza A
    111142881
   05162 Measles
    111142881
   05168 Herpes simplex virus 1 infection
    111142881
   05163 Human cytomegalovirus infection
    111142881
   05167 Kaposi sarcoma-associated herpesvirus infection
    111142881
   05169 Epstein-Barr virus infection
    111142881
   05165 Human papillomavirus infection
    111142881
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111142881
   05140 Leishmaniasis
    111142881
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111142881
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111142881
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111142881
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111142881
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 DUF4079
Other DBs
NCBI-GeneID: 111142881
NCBI-ProteinID: XP_022351982
UniProt: A0A2Y9ITG3
LinkDB
Position
Unknown
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEI
CIRAAQECCISPLCHNLFALYDENSKLWYAPNRAITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHPNDSGNVLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLIDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGT
LVDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
YSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPLHCPDEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagacggaggtgaatctggaggcccctgagccaggagtggaagtgctcttc
tatctttctgatagggagcccctccggctgggcagcggagagtacaccgcggaggagatc
tgcatcagggcggcgcaggaatgctgtatctctccactgtgtcacaacctctttgccctg
tatgatgagaacagcaagctctggtatgccccgaatcgcgccatcactgttgacgacaag
acatccctccggctccactaccggatgaggttctatttcaccaactggcatgggaccaat
gataatgagcagtccgtatggcgacattctccaaagaagcagaaaaatggctatgagaaa
aaaaaagtcccagatgcaacccctctccttgatgccagttctttggaatatctgtttgct
cagggacagtatgatttggtcaaatgtctggctcccattcgagaccccaagaccgagcaa
gatgggcacgatattgagaatgagtgtctgggaatggctgtcctggccatctcccactac
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctgaaggaatttaacaacaagactatttgtgacagcagt
gtatctactcatgacctaaaggtgaagtacttagccaccttggaaacactgacaaaacat
tatggcgcagaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcatccgaacgacagtggaaatgttctctactatgaagtgatggtaactggaaat
cttggaatccagtggagacagaaaccaaacgttgttcctgttgaaaaggaaaaaaacaaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaaaatccgg
gaggagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcatcaataaacaggacaacaaaaaaatggaactgaagctctcgtcccatgaa
gaggccttgtcctttgtgtccctgatagatggctacttccggctcacagcagatgcccat
cattacctctgcaccgatgtggctcccccattgatcgtccacaacatacagaatggttgt
cacggtccaatctgcacggaatatgccatcaataagttgcggcaagaaggaagcgaggag
gggatgtatgtgctgaggtggagctgtactgactttgacaatatcctcatgacggtcacc
tgctttgagaaatctgaggtgctgggaggccagaagcagttcaagaactttcagatcgaa
gtgcagaagggccgctatagcctgcacggctcggaccgcagcttccccagcctgggggac
ctgatgagccacctcaagaagcagatcctgcgcacggacaacatcagcttcgtgctgaag
cgctgctgccagcccaagccccgagagatctccaatctgctggtggctacgaagaaagcc
caggagtggcagcctgtctaccccatgagccagctgagttttgaccgaatcctcaagaaa
gatatcgtgcaaggtgagcatctcgggagaggcacacggacacacatctactccggcacc
ctggtggattacaaggatgacgaagggacttccgaagagaagagaataaaagtgatcctc
aaagtcttagaccccagccacagggacatttctctggccttctttgaagcagccagcatg
atgaggcaggtctcccacaaacacatcgtgtacctctatggtgtctgtgtccgagatgtg
gagaatatcatggtggaggagtttgtggaaggggggccccttgatctcttcatgcatcgg
aaaagcgatgtcctcactacaccatggaagttcaaagttgccaaacagctagccagcgcc
ctcagttacttggaggacaaagacctggtccacggaaatgtgtgcacgaaaaaccttctc
ctggcccgtgagggcattgacagcgagtgtggcccgttcatcaagctcagtgaccctggc
atccccattaccgtgctgtccaggcaagagtgcatagaacgaatcccgtggattgctccc
gagtgtgttgaagactccaagaacctgagtgtggctgctgacaaatggagctttggaacc
acactctgggaaatctgctacaatggcgagatccctctgaaagacaagaccctgattgag
aaagagagattctacgaaagccggtgccggccagtgacgccatcttgtaaggagctggct
gacctcatgacacgctgcatgaactatgaccccaaccagagacccttcttccgagccatc
atgagagacatcaacaaactagaagagcagaatccagacattgtttctgaaagaaagccg
gcaaccgaagtagatcccacacattttgaaaagcggttcttgaagaggatccgtgacttg
ggagagggccactttgggaaggttgagctctgcaggtatgaccctgagggggacaatact
ggggagcaagtggcggtgaagtccctgaagcccgagagtggaggcaaccacatagctgat
ctgaagaaggaaattgaaatcctaaggaacctctatcacgagaacattgtgaaatacaaa
ggcatctgtacggaagacggaggaaatggtattaagctcatcatggaatttctgccttca
ggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcaatta
aaatacgccgttcagatttgtaaggggatggactatttgggttctcggcagtacgttcac
cgggacttggcagcaagaaatgtcctcgtcgagagtgagcaccaagtgaaaattggagac
tttggtttgaccaaagcaatcgaaactgacaaagagtactacaccgtcaaggatgatcgg
gacagccctgtgttttggtatgctcccgaatgtttaattcagtgtaaattttacatcgcc
tctgatgtctggtcgtttggagtgactctgcatgagttgcttacttactgcgactcagat
tacagccccatggcgttgttcctgaaaatgataggcccaactcatggccagatgacagtc
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccacttcactgtcca
gatgaggtttatcaacttatgagaaaatgctgggagttccaaccatccaatcggacaact
tttcagaaccttatcgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system