KEGG   Enhydra lutris kenyoni (northern sea otter): 111142881
Entry
111142881         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04621  NOD-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05140  Leishmaniasis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05212  Pancreatic cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111142881
   04151 PI3K-Akt signaling pathway
    111142881
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111142881
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111142881
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111142881
   04658 Th1 and Th2 cell differentiation
    111142881
   04659 Th17 cell differentiation
    111142881
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111142881
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111142881
   05203 Viral carcinogenesis
    111142881
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111142881
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111142881
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111142881
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111142881
   05161 Hepatitis B
    111142881
   05160 Hepatitis C
    111142881
   05171 Coronavirus disease - COVID-19
    111142881
   05164 Influenza A
    111142881
   05162 Measles
    111142881
   05168 Herpes simplex virus 1 infection
    111142881
   05163 Human cytomegalovirus infection
    111142881
   05167 Kaposi sarcoma-associated herpesvirus infection
    111142881
   05169 Epstein-Barr virus infection
    111142881
   05165 Human papillomavirus infection
    111142881
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111142881
   05140 Leishmaniasis
    111142881
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111142881
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111142881
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111142881
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111142881
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 DUF4079
Other DBs
NCBI-GeneID: 111142881
NCBI-ProteinID: XP_022351982
UniProt: A0A2Y9ITG3
LinkDB
Position
Unknown
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEI
CIRAAQECCISPLCHNLFALYDENSKLWYAPNRAITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHPNDSGNVLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLIDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGT
LVDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
YSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPLHCPDEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagacggaggtgaatctggaggcccctgagccaggagtggaagtgctcttc
tatctttctgatagggagcccctccggctgggcagcggagagtacaccgcggaggagatc
tgcatcagggcggcgcaggaatgctgtatctctccactgtgtcacaacctctttgccctg
tatgatgagaacagcaagctctggtatgccccgaatcgcgccatcactgttgacgacaag
acatccctccggctccactaccggatgaggttctatttcaccaactggcatgggaccaat
gataatgagcagtccgtatggcgacattctccaaagaagcagaaaaatggctatgagaaa
aaaaaagtcccagatgcaacccctctccttgatgccagttctttggaatatctgtttgct
cagggacagtatgatttggtcaaatgtctggctcccattcgagaccccaagaccgagcaa
gatgggcacgatattgagaatgagtgtctgggaatggctgtcctggccatctcccactac
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctgaaggaatttaacaacaagactatttgtgacagcagt
gtatctactcatgacctaaaggtgaagtacttagccaccttggaaacactgacaaaacat
tatggcgcagaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcatccgaacgacagtggaaatgttctctactatgaagtgatggtaactggaaat
cttggaatccagtggagacagaaaccaaacgttgttcctgttgaaaaggaaaaaaacaaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaaaatccgg
gaggagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcatcaataaacaggacaacaaaaaaatggaactgaagctctcgtcccatgaa
gaggccttgtcctttgtgtccctgatagatggctacttccggctcacagcagatgcccat
cattacctctgcaccgatgtggctcccccattgatcgtccacaacatacagaatggttgt
cacggtccaatctgcacggaatatgccatcaataagttgcggcaagaaggaagcgaggag
gggatgtatgtgctgaggtggagctgtactgactttgacaatatcctcatgacggtcacc
tgctttgagaaatctgaggtgctgggaggccagaagcagttcaagaactttcagatcgaa
gtgcagaagggccgctatagcctgcacggctcggaccgcagcttccccagcctgggggac
ctgatgagccacctcaagaagcagatcctgcgcacggacaacatcagcttcgtgctgaag
cgctgctgccagcccaagccccgagagatctccaatctgctggtggctacgaagaaagcc
caggagtggcagcctgtctaccccatgagccagctgagttttgaccgaatcctcaagaaa
gatatcgtgcaaggtgagcatctcgggagaggcacacggacacacatctactccggcacc
ctggtggattacaaggatgacgaagggacttccgaagagaagagaataaaagtgatcctc
aaagtcttagaccccagccacagggacatttctctggccttctttgaagcagccagcatg
atgaggcaggtctcccacaaacacatcgtgtacctctatggtgtctgtgtccgagatgtg
gagaatatcatggtggaggagtttgtggaaggggggccccttgatctcttcatgcatcgg
aaaagcgatgtcctcactacaccatggaagttcaaagttgccaaacagctagccagcgcc
ctcagttacttggaggacaaagacctggtccacggaaatgtgtgcacgaaaaaccttctc
ctggcccgtgagggcattgacagcgagtgtggcccgttcatcaagctcagtgaccctggc
atccccattaccgtgctgtccaggcaagagtgcatagaacgaatcccgtggattgctccc
gagtgtgttgaagactccaagaacctgagtgtggctgctgacaaatggagctttggaacc
acactctgggaaatctgctacaatggcgagatccctctgaaagacaagaccctgattgag
aaagagagattctacgaaagccggtgccggccagtgacgccatcttgtaaggagctggct
gacctcatgacacgctgcatgaactatgaccccaaccagagacccttcttccgagccatc
atgagagacatcaacaaactagaagagcagaatccagacattgtttctgaaagaaagccg
gcaaccgaagtagatcccacacattttgaaaagcggttcttgaagaggatccgtgacttg
ggagagggccactttgggaaggttgagctctgcaggtatgaccctgagggggacaatact
ggggagcaagtggcggtgaagtccctgaagcccgagagtggaggcaaccacatagctgat
ctgaagaaggaaattgaaatcctaaggaacctctatcacgagaacattgtgaaatacaaa
ggcatctgtacggaagacggaggaaatggtattaagctcatcatggaatttctgccttca
ggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcaatta
aaatacgccgttcagatttgtaaggggatggactatttgggttctcggcagtacgttcac
cgggacttggcagcaagaaatgtcctcgtcgagagtgagcaccaagtgaaaattggagac
tttggtttgaccaaagcaatcgaaactgacaaagagtactacaccgtcaaggatgatcgg
gacagccctgtgttttggtatgctcccgaatgtttaattcagtgtaaattttacatcgcc
tctgatgtctggtcgtttggagtgactctgcatgagttgcttacttactgcgactcagat
tacagccccatggcgttgttcctgaaaatgataggcccaactcatggccagatgacagtc
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccacttcactgtcca
gatgaggtttatcaacttatgagaaaatgctgggagttccaaccatccaatcggacaact
tttcagaaccttatcgaaggatttgaagcacttttaaaataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111143876
Entry
111143876         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein kinase JAK3 isoform X1
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04062  Chemokine signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05161  Hepatitis B
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05223  Non-small cell lung cancer
elk05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111143876
   04151 PI3K-Akt signaling pathway
    111143876
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111143876
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111143876
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111143876
   04659 Th17 cell differentiation
    111143876
   04062 Chemokine signaling pathway
    111143876
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143876
   05203 Viral carcinogenesis
    111143876
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111143876
  09163 Immune disease
   05340 Primary immunodeficiency
    111143876
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143876
   05161 Hepatitis B
    111143876
   05162 Measles
    111143876
   05169 Epstein-Barr virus infection
    111143876
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111143876
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111143876
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111143876
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo APH SH2
Other DBs
NCBI-GeneID: 111143876
NCBI-ProteinID: XP_022353590
UniProt: A0A2Y9J6S5
LinkDB
Position
Unknown
AA seq 1107 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSYGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDSSTQVLVYRLRFYFPNWFELEKCHRFGL
RKDLASAVLDLPVLEHLFAQHRNDLVSGRLSVGLSLKEQGECLSLAVLDLARMAREQVQE
PEELLKTVSYKVCLPPDLRDLIQGLSFVTRKRIRRTVRRALRRVTACQADRHSLMAKYIM
DLERLDPAREVETFPVSLPGAAGGEDAQGLLRVAGDSGIAWSSGGQEALQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGYFRLISDSRHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTQGSRPGSYVLRRSPQDFDCFLLTVCVQTP
LGPDYKGCLIRCDPTGTFSLAGLGRPHSSLRELLAACWDGGLHVDGVALSLTFCCTPKPK
EKSNLIVVRRGCSPPTSSPLQTQSQGHLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVEGEARETEVLLKVMNAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFAHLGALDTYLRKSGHLVPASWKLQVIKQLAYALNYLEDKGLLHGNVSARKVLLAREGA
DGNLPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLLEPRTLGLEADKWGFGATVWEVFS
GIPIPISTLDPAKKLQFYKEQQQLPAPKWMELAMLIQQCMAYEAGQRPSFRAIIRDLNSL
ITSDYELLSDPTPGALAPRDGLWNGAQLYAYQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQTLKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDANRLLLYASQICKGMEYLGSRRYVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVHEPGQSPIFWYAPESLSENIFSRQSDVWSFGVILYEL
FTYGNKSCSPSAEFLRMMGMMGCDRDVPPLSCLLELLAEGQRLPAPAACPGEVHELMKLC
WAPSPKDRPTFSALGPQLDALWSASRG
NT seq 3324 nt   +upstreamnt  +downstreamnt
atggcgcctccaagcgaggagacacccctgatccctcaacgttcctgcagcctctcatct
tcagaggcgggtgccctgcacgtgctgctgccccctcggggtcctggacccccacagcgc
ctatccttctcctatggggaccattcagctgaagagctgtgtgtttgggctgctaaggcc
agtggcatcctgcctgtgtaccactccctctttgccctggccacggaggacctgtcctgc
tggttccccccgagccatatcttctccgtggaggactcaagcacccaagtcctggtctac
aggctccgcttttacttccccaactggtttgagctagagaagtgccaccgtttcgggcta
cgcaaggacttggccagcgccgtccttgacctaccagtcctggagcacctcttcgctcag
catcgaaatgacctggtgagcggccgcctctccgtgggcctcagtctcaaggagcagggg
gaatgtctcagcttggcggtgctggacctggcccggatggcccgcgagcaggttcaggaa
cccgaggagctgctgaagactgtcagctacaaggtctgcctgccccccgacctgcgcgac
ctgattcagggcctgagcttcgtgacgcggaagcgcatccggaggaccgtgcgccgggcc
ctgcgccgtgtgactgcctgccaggctgacaggcactcgctcatggccaagtacatcatg
gacctggagaggctcgacccggccagggaggtcgagaccttccccgtgagcctccccggg
gctgctggtggtgaggatgcgcaggggctgctccgagtggctggtgacagcggcatcgcc
tggagttcgggaggacaggaggccctccagcccttctgcgactttccagaaattgtggac
atcagcatcaagcaggctccgcgtgttggcccggccggggagcaccgcctggtcaccgtc
accaggacggacaaccagatcctggaggcggagttcccggggctgcccgccgcgttgtcc
ttcgtggctctcgtcgatggctacttccggctgatctccgactccaggcacttcttctgc
aaggaggttgcgccgccacggctgctggaggaagtggccgagcagtgccacggccccatc
accctggattttgccatcaacaaactcaagacccagggctcacgtcccggctcctacgtt
ctccgccgcagtccccaggattttgactgcttcctcctcactgtctgtgttcagaccccc
ctgggtcctgattacaagggctgcctcatccgctgtgaccccacaggaaccttctccctg
gctggcctcggccgtccccacagcagtcttcgagagctcttggcagcctgctgggatggc
gggctgcacgtggatggggttgcgctaagcctcactttctgctgcacccccaaacccaaa
gaaaagtccaacctgattgtggtacggaggggttgcagcccacccacgtcatcccctctt
cagacccaatcccaaggccatctgagtcagatgacgtttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggtcatggatcattcaccaagatttaccggggttgtcgc
catgaggtcgtggagggggaggcccgggagacagaggtgctgctcaaagtgatgaatgcc
aagcataaaaactgcatggagtcatttctggaagctgcgagtctgatgagccaagtgtca
taccagcatctcgtgttgctccatggcgtgtgcatggctggagacagtatcatggtgcag
gaatttgcacacctgggagcgctggacacctacctgcgcaagtctggccacctggtgcca
gccagctggaagctgcaggtgatcaaacagctggcctatgccctcaactatctggaggac
aaaggcctcctccatggcaatgtctcagcccggaaggtgcttctggctcgcgaaggggct
gatgggaacctgcccttcatcaagcttagtgaccctggggtcagccctgctgtgctaagc
ctggagatgctcacagacaggatcccatgggtggcccctgagtgtctcctggagccccgg
acactcggcttggaagctgacaagtggggttttggtgccacagtctgggaggtgttcagc
gggatcccgatacccatcagcaccctggatcctgccaagaagctccagttttataaagaa
cagcagcagctccctgcccccaagtggatggagctcgccatgctgatccaacagtgcatg
gcctacgaggcaggccagaggccctccttccgtgccatcatccgtgacctgaacagcctc
atcacttcagattatgagctcctctcagaccccacacctggtgccttggcaccccgtgat
gggctatggaatggcgcccagctctacgcctaccaagaccctactattttcgaggagaga
cacctcaagtacatctcacagctgggcaagggcaacttcggcagcgtggaactgtgccgc
tatgacccgctgggtgacaacacaggcgccctagtggcagtgaagcagctgcagcacagc
gggccagatcagcagagggacttccagagggagatccagaccctcaaagccctccacagt
gacttcattgtcaagtaccgtggtgtcagctatggcccaggccgccagagcctgcggctg
gtgatggagtacctgcccagcggctgcttgcgggacttcctacagcggcaccgcgcgcgc
ctcgatgccaaccgtctgctcctctacgcctcgcagatctgcaagggcatggagtacctg
ggctcccgccgctacgtgcaccgcgaccttgccgcacgtaacatcctggtggagagcgag
acgcatgtcaagatcgccgacttcggcctcgccaagctgctgccgctcgacaaagactac
tacgtggtccacgagcccggccagagccccatcttctggtacgccccagagtctctctct
gagaacatcttctcgcgccagtcggacgtctggagcttcggggtcatcctgtacgagctt
ttcacctacgggaacaagagctgcagcccctcagccgagttcctgcggatgatggggatg
atgggatgtgatcgagatgtcccgcccctctcctgcctgctggagcttctggctgagggc
cagaggctgccggcgcctgctgcctgccctggtgaggttcatgagctcatgaagctgtgc
tgggcccctagcccgaaagaccgaccaacattcagtgccttgggccctcagctggatgca
ctatggagtgcaagccgggggtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153517
Entry
111153517         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04062  Chemokine signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04217  Necroptosis
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04725  Cholinergic synapse
elk04917  Prolactin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05140  Leishmaniasis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05200  Pathways in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111153517
   04151 PI3K-Akt signaling pathway
    111153517
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111153517
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111153517
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111153517
   04659 Th17 cell differentiation
    111153517
   04062 Chemokine signaling pathway
    111153517
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111153517
   04917 Prolactin signaling pathway
    111153517
   04935 Growth hormone synthesis, secretion and action
    111153517
  09156 Nervous system
   04725 Cholinergic synapse
    111153517
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111153517
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111153517
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111153517
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111153517
  09172 Infectious disease: viral
   05161 Hepatitis B
    111153517
   05164 Influenza A
    111153517
   05168 Herpes simplex virus 1 infection
    111153517
   05167 Kaposi sarcoma-associated herpesvirus infection
    111153517
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111153517
   05140 Leishmaniasis
    111153517
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111153517
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111153517
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111153517
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111153517
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr FERM_F2 FERM_F1 Pkinase Jak1_Phl SH2
Other DBs
NCBI-GeneID: 111153517
NCBI-ProteinID: XP_022368281
UniProt: A0A2Y9K4R8
LinkDB
Position
Unknown
AA seq 974 aa
MGMACLTMTEMEGTSVSPVHQNGDIPGNANPVKQIDPLLQVYLYHSLEKAEGEYLKFPTG
EYVAEEICVAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PYWYCNGSNRTYRYGISRGAEAPLLDDFVMAYLFAQWRHDFLHGWIKIPVTHETQEECLG
MAVLDMMRLAKEKDQTPLDIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVTIKQASQEGSNESRIVAIHKQDGKNLEIELSSLK
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENAIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKLKDKSNLLVFRTSGVSDVPTSPTLQRHNNVNQMVFHKI
RNEDLMFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKALVHGNVCAKNILLIREEDRKTGNLPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKFVCYRYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPP
AEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYLIMTECWNNNVNQRPSFRD
LALRVDQIRDNMAG
NT seq 2925 nt   +upstreamnt  +downstreamnt
atggggatggcttgccttacaatgacagaaatggaaggaacgtccgtatctcctgtacat
cagaatggtgatattcctggaaatgctaatccggtgaagcaaatagatccactcctgcag
gtgtatctttatcattctcttgagaaagctgaaggagagtatctgaagtttccaactggg
gagtatgttgcagaagaaatttgtgttgctgcttctaaagcttgtggaatcacaccagtg
tatcatagtatgtttgctttaatgagtgaaacagaaaggatttggtatccgcccaaccat
gtcttccatatagatgaatcaaccaggcacaatgtactctacagaataagattttacttt
ccttactggtattgtaacggcagcaacagaacctatcggtatgggatatctcgaggtgct
gaagctcctcttcttgacgactttgtcatggcctacctttttgctcagtggcggcatgat
tttttacatggatggataaaaatacccgtgactcatgaaacacaagaagagtgtcttgga
atggctgtattagatatgatgagactagccaaagagaaggatcagaccccattggacatc
tatagctctatcagctacaagacattcttaccaaaatgtgttcgagcaaagatccaagac
tatcatattttgacaaggaaacgaataaggtacagatttcgcagatttattgagcagttc
agccattgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgtgacttc
cctgatattattgatgttactattaagcaagcaagccaagaaggctcaaatgaaagtaga
attgtagctatacataagcaagatggtaaaaatctggaaattgaacttagctcattaaaa
gaagctttgtcctttgtgtcattaattgatggctattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcacctccaatggtccttgaaaatatacaaagcaactgt
catggcccaattttaatggattttgccatcagtaaactgaagaaagcaggtaatcagact
ggactctacgtacttcgatgcagtcctaaggactttaataagtattttctgacttttgct
gttgagcgagaaaatgccatcgaatataagcactgtttgattacaaagaatgagaatgga
gaatacaacctcagtgggaccaagaagaacttcagtaaccttaaagatcttttgaattgc
taccagatggaaactgttcgctcagacagtataattttccagtttactaaatgttgtccc
ccaaagttgaaagataaatcaaaccttctagtcttcagaaccagtggcgtttctgatgtt
cccacatcaccaacattacagaggcataataatgtgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatgtttaatgaaagccttggccaaggcacttttacaaaaattttt
aaaggtataaggagagaagtaggagattatggtcaactacatgaaacagaagttctttta
aaagttctggataaagctcacagaaactattccgagtctttctttgaagcagcaagcatg
atgagccagctttctcacaagcatctagttttaaattatggagtgtgtgtctgtggggag
gagaatattctggttcaagagtttgtaaaatttggatccttagatacatatctgaaaaag
aataaaaattctataaatatattatggaaacttgaagtggctaaacagttggcatgggcc
atgcattttctagaagaaaaagcacttgttcatggaaatgtgtgtgccaaaaatattctg
cttatcagagaagaagacaggaagacaggaaatcttcctttcatcaaacttagtgatcct
ggtattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatctaaatttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataaacctctgagtgctttggattctcaa
agaaagctacagttttacgaagataggcaccagcttcctgcaccaaagtggacagaatta
gcaaatcttattaataattgtatggattatgaaccagatttcagaccttctttcagagcc
atcatacgagatcttaatagtttgtttactccagattatgaactattaacagaaaatgat
atgttaccaaatatgagaataggtgccctagggttttctggtgcttttgaagaccgagac
cctacacaatttgaagagagacacttgaaatttctacagcaacttggcaagttcgtatgt
tataggtatgctccagaatcattgacagagagcaagttttctgtggcttcagatgtttgg
agctttggagtggttctctatgaacttttcacatatattgagaagagtaaaagtccccca
gcggaatttatgcgtatgattggcaatgacaaacaaggacagatgattgtgtttcatttg
atagaactcctaaagaataacggaagattaccaagaccagatggatgcccagatgagatt
tatttgatcatgacggaatgctggaataataatgtcaatcaacgcccctcttttagagac
ctagctcttcgagttgatcaaataagggacaacatggctggatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162402
Entry
111162402         CDS       T05871                                 

Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04621  NOD-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk05145  Toxoplasmosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111162402
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111162402
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111162402
   04658 Th1 and Th2 cell differentiation
    111162402
   04659 Th17 cell differentiation
    111162402
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111162402
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    111162402
   05160 Hepatitis C
    111162402
   05171 Coronavirus disease - COVID-19
    111162402
   05164 Influenza A
    111162402
   05162 Measles
    111162402
   05168 Herpes simplex virus 1 infection
    111162402
   05167 Kaposi sarcoma-associated herpesvirus infection
    111162402
   05169 Epstein-Barr virus infection
    111162402
   05165 Human papillomavirus infection
    111162402
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111162402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111162402
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111162402
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111162402
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like APH Kdo RIO1
Other DBs
NCBI-GeneID: 111162402
NCBI-ProteinID: XP_022382508
UniProt: A0A2Y9LBA5
LinkDB
Position
Unknown
AA seq 1195 aa
MAYLFLAKPAVKSMSLCHWGATTRDSRPDGNGAQPMATRGGLKVLLHWAGPGGGDPWVTF
SEATLTAEEVCIHIAQKVGITPSCLNLFALFDAQAQVWLPPNHVLEIPRDMSLTLYFRMR
FYFRNWHGTNPQEPAVYRCGPPGPKSSSEQAEQGMQLLDPASFEYLFEQGKHEFVNDVAS
LWELSSEEEIHHFKNESLGMAFLHLCHLALCRGVPLEKVAKKISFKDCIPRSFQLQIRRH
NALTRLRLRNIFRRFVRAFQPGHVSQQVIMVKYLATLEQLAPRFGTERLPVCHLELLAQA
VGEPYYFRDAGQAPPEPGPELATGPPTHEVLVTGTGGIQWRPVRAEGPRGDGSSRNPHAG
PFGKRTKAPAAGDQPADRPQEALWTYFCDFQDITHVVLKECHVSIHCQDNKSLELTLPSR
AMALSLVSLVDGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLLEPFVLAKLRPEDGL
YLIHWSTSHLNRLILTVAQREQAPGTQHVHLRKFPIELQAGVFTLEGWDRSFPSVRELRA
ALQGCCLRAGDDCFALRRCCLPRPGEISNLIIMRGSRASTAPPNLSQLSFHRISQDDITQ
LSHLGQGTRTNVYEGILRVGGRGPKEDTADNEDPPTPSGDCGQELRVILKVLDPSHHDIA
LAFYETASLMSQVSHVHLAFVHGICVHGSENIMVAEYVEHGPLDVWLRREKGHVPVAWKV
VVAQQLASALSYLEDKSLVHGNVCGRNILLARLGLTEGTSPFIKLSDPGVGLGALSREER
VERIPWTAPECLSGGANSLTTAADKWGFGATLLEICFDGEAPLQGRGPSEKECFYQKQHQ
LPQPSCPELATLTSQCLTYEPAQRPSFRTILRDLTQLQPQNLADVLAVNLDSPASDPTVF
HKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCDPQLRTSWRREIDILR
TLYHKHIVKYKGCCEDAGEKSVPLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMA
YLHTQHYVHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPEC
LKECKFYYASDVWSFGVTMYELLTYCDSSQSPPSKFMELIGLTQGQMTVLRLTELLERGE
RLPRPERCPCEIYLLMKNCWEAEASFRPTFQNLIPILKTVQEKYQGQAASVFNVC
NT seq 3588 nt   +upstreamnt  +downstreamnt
atggcctatctctttctagccaagccagctgtcaaaagcatgtctctgtgccactggggt
gccaccaccagggacagcaggcctgatggcaatggagctcagcccatggccaccagggga
ggcctgaaggtccttctgcactgggctggccctggcggcggggacccctgggtcaccttc
agcgaggccacactgaccgcagaggaggtctgcatccacattgcacaaaaagtcggcatc
actccatcctgcctcaatctctttgctctcttcgatgcccaggcccaggtctggctgccc
ccaaaccatgtcttggagatccccagagacatgagcctgacactgtactttcgcatgagg
ttttatttccggaactggcatggcacaaacccccaggagccggctgtgtaccgctgtggg
cctccagggcccaagtcttcctctgaacaggcagagcagggcatgcaactactggacccg
gcctcctttgagtacctctttgagcagggcaagcatgagtttgtgaatgacgtagcatcg
ctgtgggagctgtccagcgaggaggagatccaccattttaagaacgagagtctgggcatg
gcctttctgcacctgtgccaccttgccctgtgccgtggcgtccccctggagaaggtggcc
aagaagatcagcttcaaggactgcatcccacgctccttccagctgcagatccggcggcac
aacgcgctgacccgactgcgcctgcggaacatcttccgcaggttcgtgcgggccttccag
ccgggccacgtctcgcagcaggtcatcatggtcaaatacctggccacgctcgagcagctg
gcaccccgtttcggcacggagcgcctgcccgtgtgccacctggagctactggcccaggcc
gtgggggagccctactacttccgggacgccgggcaggctcccccagagcctgggccggag
ttggccaccggaccacccactcacgaggtgctggtgacgggcacaggtggcatccagtgg
cggccggtgcgggcagagggtcccagaggcgatggcagcagcaggaatccccatgctggc
ccatttgggaagagaaccaaggccccagcagcaggcgaccagccagcagacaggcctcag
gaagcactgtggacctacttctgtgacttccaggacatcacacacgtggtgctgaaggaa
tgccacgtcagcatccactgtcaggacaacaagagcctggagctgaccctgccttcccgg
gccatggccctgtccttggtgtcactggtggatggctatttccgcctgaccgcagactcg
agccactacctgtgccacgaggtggctccgccacggctggtgatgagcatccaggacggg
atccatggacccctgctggagccatttgtgctggccaagctgcggcccgaggacggcctc
tacctcatccactggagcaccagccacctcaaccgcctcatcctcacggtggcgcagaga
gagcaagccccaggcacacagcacgtgcacctgcgcaaattccccattgagctgcaggcc
ggggtcttcacactagagggctgggaccggtccttccccagcgtgcgggagctgcgagcc
gccctgcagggttgctgcctgcgggctggcgatgactgcttcgccctgcgccgctgttgc
ctgccacggcccggagagatctccaacctcatcatcatgcgggggtctcgggccagcact
gctccgcccaacctcagccagctcagcttccaccggatcagccaggatgacatcacccag
ctgtcccacttgggccaaggcacgaggaccaacgtgtacgagggcatcttacgagtgggg
ggcagaggccccaaggaggacacggcagacaatgaggacccccccacgcccagtggggac
tgtgggcaagagctccgagtgatactcaaggtgctggaccccagtcaccacgacatcgcc
ctggccttctacgagacagccagtctcatgagccaggtctcccacgtgcacctggccttt
gtacacggcatctgcgtacatggctctgagaacatcatggtggcagagtacgtggagcac
gggcccctggacgtgtggctgcggcgagagaagggccacgtgcctgtggcctggaaggtg
gtggtggcccagcagctggccagtgccctcagctacctggaagacaagagcctggttcat
ggtaatgtgtgtggccggaatatcctactggcacggctggggctgacggagggcaccagc
cccttcatcaagctgagcgaccccggtgtgggcctgggtgccctttccagggaagagcgg
gtggagcggatcccctggacagcccctgagtgcctctctggcggagccaacagtctgacc
actgcggccgataaatggggctttggtgccaccctcctggagatctgcttcgatggggag
gcccctctgcagggccgtggcccctccgagaaagagtgcttctaccagaagcagcaccag
cttcctcagccctcctgcccggagctcgccacactcaccagccagtgcctgacctatgaa
ccagctcagcggccctccttccgcacaatcctgcgggacctcactcagctgcagccccag
aatcttgctgacgtcttggctgtgaaccttgactcacctgcgtcagaccccaccgtgttc
cacaagcgctatttgaaaaagatccgagatctgggcgagggccatttcggcaaggtcagt
ctgtactgctacgaccccacgaacgacggcaccggcgagatggtggccgtgaaggccctc
aaggcggactgcgacccccagctccgcaccagctggcggcgggagatcgacatcctgcgc
acgctgtaccacaagcacattgtcaagtacaagggctgctgcgaggacgcaggagagaaa
tcggtaccgctggtcatggagtatgtgcccctgggaagcctgcgagactacctgccccgg
cacagcgtggggctggctcagctgctgctcttcgcccagcagatctgtgagggcatggcc
tacctccacacacagcactacgtgcaccgagacctggcggcccgcaacgtgctgctggac
aacgacaggctggtcaaaatcggggactttggcctagccaaggctgtgcccgaaggccat
gagtactaccgcgtgcgcgaggatggggacagccccgtattctggtatgccccagagtgc
ctgaaggagtgtaagttctactatgcctccgatgtctggtccttcggggtcaccatgtac
gagctgctgacctactgtgactccagccagagccccccctcgaaattcatggagctcata
ggcctcacccaggggcagatgacggtgctgaggctcactgagctgctggaacgcggggag
aggctgccccggccggagagatgtccttgtgagatctatctcctcatgaagaactgctgg
gaggcggaggcctcattccgccccaccttccagaacctcatacccattctcaagacagtc
caggagaaataccaaggccaggccgcctcagtgttcaatgtgtgctga

DBGET integrated database retrieval system