KEGG   Enhydra lutris kenyoni (northern sea otter): 111143139
Entry
111143139         CDS       T05871                                 

Definition
(RefSeq) cell division cycle protein 20 homolog isoform X1
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04114  Oocyte meiosis
elk04120  Ubiquitin mediated proteolysis
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111143139
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111143139
   04114 Oocyte meiosis
    111143139
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111143139
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143139
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111143139
   03036 Chromosome and associated proteins [BR:elk03036]
    111143139
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     111143139
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    111143139
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb
Other DBs
NCBI-GeneID: 111143139
NCBI-ProteinID: XP_022352346
UniProt: A0A2Y9IVG5
LinkDB
Position
Unknown
AA seq 499 aa
MAQFVFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKTQTTPSKPGGDRYIPHRSASQMEVASFLLSKENQPEDSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGDYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVSSLCWNSYIVSSGSRSGQIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAQSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgcagttcgtgttcgagagcgacctgcactcgctgctgcagctggacgcacctatc
cccaatgcaccccccgcgcgctggcagcgcaaagctaaggaagccgcggggccggccccc
tcacccatgcgggcggccaaccgatcccacagcgccggcaggaccccaggccgaactccc
ggcaaatccagctccaagactcagaccactcccagcaaacctggcggtgaccgctacatc
ccccatcgcagtgcttcccagatggaggtggccagtttcctcctgagcaaggaaaaccag
cctgaagatagccagacgcccaccaagaaggaacatcagaaagcctgggctttgaacctg
aacggttttgatgtggaggaagccaagatccttcggctcagtggaaaaccacaaaatgcc
ccagagggttaccagaacagactgaaagtgctttacagccagaaggccacgcctggctcc
agccggaagacctgccgttatattccttccctgccagatcgaatcctggacgcccctgaa
atccggaatgactactacctgaaccttgtggactggagctctggaaatgtactggctgtg
gcattggacaacagcgtgtacttgtggagtgctagctccggggacatcttgcagctgctg
caaatggagcagcctggggactatatatcttctgtggcctggatcaaagagggcaactac
ctggcagtgggcaccagcagtgccgaggtgcagctatgggatgtgcagcagcagaagcgg
cttcgaaacatgactagtcattccgcccgtgtgagctccctgtgttggaacagctacatc
gtgtccagtggctcacgttctggccagatccaccaccatgatgttcgggtggcagaacac
catgtggccaccctgagcggccacagccaggaggtgtgtgggctgcgctgggccccagat
ggacgacatttggccagcggcggcaacgataacttggtcaacgtgtggcctagtgctcct
ggagagggtggctgggttcccctgcagacattcacccagcatcagggggctgtcaaggct
gtagcttggtgtccctggcagtccaatgtcctggcgactggagggggcaccagtgaccga
cacattcgcatctggaatgtctgctctggggcctgtctgagtgctgtggatgctcaatcc
caggtgtgctccatcctctggtctccccactacaaggagctcatctcaggccatggcttt
gcccagaaccagttggttatttggaagtacccaaccatggccaaggttgctgagcttaaa
ggtcacacggcccgggtcctgagtctgaccatgagcccagacggggccaccgtggcctca
gcagcagcagatgagaccctgcggctgtggcgctgctttgagctggaccctgcgcggcgg
cgggagcgggagaaggccagcgcagccaagagcagcctcatccaccagggcatccgttga

DBGET integrated database retrieval system