KEGG   Enhydra lutris kenyoni (northern sea otter): 111143151
Entry
111143151         CDS       T05871                                 

Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04110  Cell cycle
elk04934  Cushing syndrome
elk05166  Human T-cell leukemia virus 1 infection
elk05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111143151
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111143151
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111143151
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143151
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111143151
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 111143151
NCBI-ProteinID: XP_022352364
UniProt: A0A2Y9IYD8
LinkDB
Position
Unknown
AA seq 168 aa
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLPVVE
FLMKHTASKVGHRNHKGDTACDLARLYRRNEVVSLMEGNQAEGASNLQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtctgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact
gcgctgcaggttatgaaacttggaaatcctgagattgccaggagactactacttagaggt
gctaatcccgatttgaaagaccgaactggtttcgctgtcattcatgatgcagccagagca
ggtttcctggacactttacagactttgctggagttccaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccctgtggtggag
ttcctcatgaagcacacagccagcaaagtggggcatcggaaccataagggggacaccgcc
tgcgacttggccaggctctaccggaggaatgaggtcgttagcctaatggagggaaaccag
gcggagggagcttcgaatttgcaatga

DBGET integrated database retrieval system