KEGG   Enhydra lutris kenyoni (northern sea otter): 111143201
Entry
111143201         CDS       T05871                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04064  NF-kappa B signaling pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04218  Cellular senescence
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111143201
   04064 NF-kappa B signaling pathway
    111143201
   04068 FoxO signaling pathway
    111143201
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111143201
   04210 Apoptosis
    111143201
   04115 p53 signaling pathway
    111143201
   04218 Cellular senescence
    111143201
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143201
   05202 Transcriptional misregulation in cancer
    111143201
  09162 Cancer: specific types
   05210 Colorectal cancer
    111143201
   05212 Pancreatic cancer
    111143201
   05225 Hepatocellular carcinoma
    111143201
   05226 Gastric cancer
    111143201
   05214 Glioma
    111143201
   05216 Thyroid cancer
    111143201
   05220 Chronic myeloid leukemia
    111143201
   05217 Basal cell carcinoma
    111143201
   05218 Melanoma
    111143201
   05213 Endometrial cancer
    111143201
   05224 Breast cancer
    111143201
   05222 Small cell lung cancer
    111143201
   05223 Non-small cell lung cancer
    111143201
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111143201
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111143201
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111143201
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111143201
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 111143201
NCBI-ProteinID: XP_022352459
UniProt: A0A2Y9IYN0
LinkDB
Position
Unknown
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDASPASSEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagactgaaaggatggataaggtgggc
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tacgaggcggccaagctgctcaacgtcgaccccgataacgtggtgctgtgtctgctggct
gcggacgaggacgacgacagggatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccgactggccgag
ctcctgctcctggagacggacgccagcccagcctcgagcgagggcgccgagcagcccccg
gacctgcactgcgtcctggtgacgaatccacattcatcacagtggaaggatcctgcccta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153625
Entry
111153625         CDS       T05871                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04064  NF-kappa B signaling pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04218  Cellular senescence
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111153625
   04064 NF-kappa B signaling pathway
    111153625
   04068 FoxO signaling pathway
    111153625
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111153625
   04210 Apoptosis
    111153625
   04115 p53 signaling pathway
    111153625
   04218 Cellular senescence
    111153625
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111153625
   05202 Transcriptional misregulation in cancer
    111153625
  09162 Cancer: specific types
   05210 Colorectal cancer
    111153625
   05212 Pancreatic cancer
    111153625
   05225 Hepatocellular carcinoma
    111153625
   05226 Gastric cancer
    111153625
   05214 Glioma
    111153625
   05216 Thyroid cancer
    111153625
   05220 Chronic myeloid leukemia
    111153625
   05217 Basal cell carcinoma
    111153625
   05218 Melanoma
    111153625
   05213 Endometrial cancer
    111153625
   05224 Breast cancer
    111153625
   05222 Small cell lung cancer
    111153625
   05223 Non-small cell lung cancer
    111153625
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111153625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111153625
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111153625
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111153625
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 111153625
NCBI-ProteinID: XP_022368476
UniProt: A0A2Y9K585
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEIRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADAEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAAAPGDLHCI
LISNPNEDAWKDPALEKLSVFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaggaaatccgcggccaagacacggttcccgaaagcaccgccaggatgcag
ggcgccgggaaggcgctgcacgagctgctgctgtcggcgcagcgccagggctgcctcacc
gccggcgtctatgagtccgccaaagtcctgaatgtggaccccgacaacgtgaccttctgc
gtgctggccgccgacgcggaggacgagggcgacatcgcgctgcagatccacttcacgctg
atccaggcgttctgctgcgagaacgacatagacatcgtgcgcgtgggcgacgtgcagcgg
ctggcggcgatcgtgggcgccggcgacgaggcggccgcgcctggagacttgcactgcatc
ctcatttcgaaccccaatgaggacgcgtggaaggaccccgccttggagaagctcagcgtg
ttctgcgaggagagccgcagcgtcaacgactgggtgcccagtatcaccctccccgagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161789
Entry
111161789         CDS       T05871                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04064  NF-kappa B signaling pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04218  Cellular senescence
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111161789
   04064 NF-kappa B signaling pathway
    111161789
   04068 FoxO signaling pathway
    111161789
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111161789
   04210 Apoptosis
    111161789
   04115 p53 signaling pathway
    111161789
   04218 Cellular senescence
    111161789
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161789
   05202 Transcriptional misregulation in cancer
    111161789
  09162 Cancer: specific types
   05210 Colorectal cancer
    111161789
   05212 Pancreatic cancer
    111161789
   05225 Hepatocellular carcinoma
    111161789
   05226 Gastric cancer
    111161789
   05214 Glioma
    111161789
   05216 Thyroid cancer
    111161789
   05220 Chronic myeloid leukemia
    111161789
   05217 Basal cell carcinoma
    111161789
   05218 Melanoma
    111161789
   05213 Endometrial cancer
    111161789
   05224 Breast cancer
    111161789
   05222 Small cell lung cancer
    111161789
   05223 Non-small cell lung cancer
    111161789
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111161789
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111161789
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111161789
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111161789
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 111161789
NCBI-ProteinID: XP_022381455
UniProt: A0A2Y9LIE7
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQCQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEPRDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgttggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgctggtggccgcgcagtgccaggaccgcctcaccgtgggggtg
tacgagtcagccaagttgatgaatgtggaccctgacagtgtggtcctgtgccttctggcc
attgatgaggaggaggaggatgacatcgccctgcagatccacttcacactcatccagtcc
ttttgctgtgacaacgacattaacatcgtccgggtgtcaggcatgcagcgtctggcccag
ctgctgggcgagccagcggagacccagggcaccaccgagccccgagacctgcactgcctc
ctggtcacgaaccctcacacagatgcctggaaaagccacggcctggtggaggtcgccagt
tactgcgaagagagccgagggaacaaccagtgggttccctacatctccctccaggagcgc
tga

DBGET integrated database retrieval system