KEGG   Enhydra lutris kenyoni (northern sea otter): 111143335
Entry
111143335         CDS       T05871                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1 isoform X1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04066  HIF-1 signaling pathway
elk04911  Insulin secretion
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04922  Glucagon signaling pathway
elk04931  Insulin resistance
elk04976  Bile secretion
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05211  Renal cell carcinoma
elk05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111143335
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111143335
   04922 Glucagon signaling pathway
    111143335
   04920 Adipocytokine signaling pathway
    111143335
   04919 Thyroid hormone signaling pathway
    111143335
  09154 Digestive system
   04976 Bile secretion
    111143335
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143335
   05230 Central carbon metabolism in cancer
    111143335
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111143335
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111143335
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elk02000]
    111143335
Transporters [BR:elk02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   111143335
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    111143335
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523
Other DBs
NCBI-GeneID: 111143335
NCBI-ProteinID: XP_022352718
UniProt: A0A2Y9IW04
LinkDB
Position
Unknown
AA seq 498 aa
MPVTVWVFFSLQKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYGE
RISSATLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSSVLMGFSK
LGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVF
GLDSIMGNEDLWPLLLSVIFIPALVQCVLLPFCPESPRFLLINRNEENRAKSVLKKLRGT
ADVTRDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYS
TSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIA
LALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTS
NFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQ
NDKTPEELFHPLGADSQV
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgcctgtaacagtgtgggtcttcttttctctgcagaagctgacgggccgtctcatgttg
gctgtgggaggggcagtgctcggctccctacagtttggctacaacactggagtcatcaat
gccccgcagaaggtgatcgaggagttctacaaccagacatggatccaccgctatggggag
cgcatctcgtcagccacgctcaccaccctgtggtccctctctgtggccattttctctgta
ggaggcatgattggctccttctctgtgggcctttttgttaaccgctttggccggcggaac
tccatgctgatgatgaacctgctggccttcgtgtcctctgtgctcatgggcttctcgaaa
ctgggcaagtcctttgagatgctcatcctgggccgcttcatcattggtgtgtactgtggc
ctgaccacaggcttcgtgcccatgtacgtgggggaggtgtcccctacggccctccgcggg
gccctgggcaccctgcaccagctgggcatcgtcgtcggcatcctcattgcccaggtgttc
ggcctggactccatcatgggcaacgaggacctgtggcccctgctgctgagcgtcatcttc
atcccggccctggtgcagtgcgtcctgcttcccttctgccccgagagcccccgcttcctg
ctcatcaaccgcaacgaggagaaccgggccaaaagtgtgctgaagaagctgcgcgggacg
gctgatgtgacccgagacctgcaggagatgaaggaggagagtcggcagatgatgcgggag
aagaaggtcaccatcctggagctgttccgctcgcccgcctaccgccagcccatcctcatc
gctgtggtgctgcagctgtcccagcagctgtcgggcatcaatgctgtgttctattactcc
acgagcatcttcgagaaggcgggggtgcagcagcctgtgtacgccaccatcggctccggc
atcgtcaacacggccttcactgtcgtgtcgctgtttgtggtggagcgcgctggccgccgg
accctgcacctcatcggcctggccggcatggcaggctgtgccgtgctcatgaccatcgcg
ctggcgttgctggaacagctgccctggatgtcctatctcagcatcgtggccatcttcggc
tttgtggccttcttcgaagtgggccctggccccatcccatggttcattgtggctgaactc
ttcagccagggtccccgcccagctgccattgctgttgctggcttctccaactggacctcg
aatttcattgtgggcatgtgctttcagtatgtcgagcaactgtgtgggccgtatgtcttc
atcatcttcaccgtgctactggttctcttcttcatcttcacctacttcaaagtgcctgag
acgaaaggccggacctttgacgagattgcttccggtttccggcaggggggagccagccaa
aatgacaagacacccgaggagctcttccaccccctgggagctgattcccaagtgtga

DBGET integrated database retrieval system