KEGG   Enhydra lutris kenyoni (northern sea otter): 111143399
Entry
111143399         CDS       T05871                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04020  Calcium signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04114  Oocyte meiosis
elk04140  Autophagy - animal
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04340  Hedgehog signaling pathway
elk04371  Apelin signaling pathway
elk04530  Tight junction
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04727  GABAergic synapse
elk04728  Dopaminergic synapse
elk04740  Olfactory transduction
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04910  Insulin signaling pathway
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04976  Bile secretion
elk05012  Parkinson disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05034  Alcoholism
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111143399
   04014 Ras signaling pathway
    111143399
   04310 Wnt signaling pathway
    111143399
   04340 Hedgehog signaling pathway
    111143399
   04371 Apelin signaling pathway
    111143399
   04020 Calcium signaling pathway
    111143399
   04024 cAMP signaling pathway
    111143399
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111143399
  09143 Cell growth and death
   04114 Oocyte meiosis
    111143399
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111143399
   04540 Gap junction
    111143399
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111143399
   04062 Chemokine signaling pathway
    111143399
  09152 Endocrine system
   04911 Insulin secretion
    111143399
   04910 Insulin signaling pathway
    111143399
   04922 Glucagon signaling pathway
    111143399
   04923 Regulation of lipolysis in adipocytes
    111143399
   04912 GnRH signaling pathway
    111143399
   04913 Ovarian steroidogenesis
    111143399
   04915 Estrogen signaling pathway
    111143399
   04914 Progesterone-mediated oocyte maturation
    111143399
   04921 Oxytocin signaling pathway
    111143399
   04926 Relaxin signaling pathway
    111143399
   04935 Growth hormone synthesis, secretion and action
    111143399
   04918 Thyroid hormone synthesis
    111143399
   04919 Thyroid hormone signaling pathway
    111143399
   04928 Parathyroid hormone synthesis, secretion and action
    111143399
   04916 Melanogenesis
    111143399
   04924 Renin secretion
    111143399
   04925 Aldosterone synthesis and secretion
    111143399
   04927 Cortisol synthesis and secretion
    111143399
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111143399
   04270 Vascular smooth muscle contraction
    111143399
  09154 Digestive system
   04970 Salivary secretion
    111143399
   04971 Gastric acid secretion
    111143399
   04976 Bile secretion
    111143399
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111143399
   04961 Endocrine and other factor-regulated calcium reabsorption
    111143399
  09156 Nervous system
   04724 Glutamatergic synapse
    111143399
   04727 GABAergic synapse
    111143399
   04725 Cholinergic synapse
    111143399
   04728 Dopaminergic synapse
    111143399
   04726 Serotonergic synapse
    111143399
   04720 Long-term potentiation
    111143399
   04723 Retrograde endocannabinoid signaling
    111143399
  09157 Sensory system
   04740 Olfactory transduction
    111143399
   04742 Taste transduction
    111143399
   04750 Inflammatory mediator regulation of TRP channels
    111143399
  09149 Aging
   04211 Longevity regulating pathway
    111143399
   04213 Longevity regulating pathway - multiple species
    111143399
  09159 Environmental adaptation
   04713 Circadian entrainment
    111143399
   04714 Thermogenesis
    111143399
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143399
   05205 Proteoglycans in cancer
    111143399
   05203 Viral carcinogenesis
    111143399
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111143399
   05020 Prion disease
    111143399
  09165 Substance dependence
   05030 Cocaine addiction
    111143399
   05031 Amphetamine addiction
    111143399
   05032 Morphine addiction
    111143399
   05034 Alcoholism
    111143399
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111143399
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111143399
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143399
   05163 Human cytomegalovirus infection
    111143399
   05165 Human papillomavirus infection
    111143399
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111143399
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111143399
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111143399
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111143399
   03036 Chromosome and associated proteins [BR:elk03036]
    111143399
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111143399
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  PKA family
   111143399
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111143399
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111143399
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 111143399
NCBI-ProteinID: XP_022352815
UniProt: A0A2Y9J431
LinkDB
Position
Unknown
AA seq 397 aa
MAAYKELPCNQYTGTTALQKLEGFASRLFHRHSKSTTHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttataaagaactaccctgtaaccagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacattctaaaagtactacacatgatcag
aaaactgctctggaaaatgacagccttcatttctctgaacatactgctttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttcttaaaaaatgggaaaatcct
gctccgaataatgctgggctggaagattttgaaaggaaaaaaacccttggaacgggttca
tttggaagagtcatgttggtaaaacataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaagctgaagcaaatagagcacaccttgaatgagaaaaga
atattacaggcggtgaattttccttttcttgttcgactggaatacgcttttaaggataat
tctaatttatacatggttatggaatatgttcctgggggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttttatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaagggtatatccaggttacagacttcgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagagataatcctcagcaag
ggctacaataaggcagtggattggtgggcattaggcgtgttaatctatgaaatggcagct
ggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggtccgattcccatcgcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggatttgacgaagcggtttggaaacctgaagaatggcgtgagtgatataaaaact
cacaagtggtttgccaccacagattggattgctatttaccagaggaaggttgaagcacca
ttcataccaaagttcagaggctctggagataccagcaactttgatgactatgaagaagaa
gatatccgcgtctctataacagaaaaatgtgcaaaagaattttgtgaattttaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162516
Entry
111162516         CDS       T05871                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04020  Calcium signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04114  Oocyte meiosis
elk04140  Autophagy - animal
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04340  Hedgehog signaling pathway
elk04371  Apelin signaling pathway
elk04530  Tight junction
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04727  GABAergic synapse
elk04728  Dopaminergic synapse
elk04740  Olfactory transduction
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04910  Insulin signaling pathway
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04976  Bile secretion
elk05012  Parkinson disease
elk05020  Prion disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05034  Alcoholism
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111162516
   04014 Ras signaling pathway
    111162516
   04310 Wnt signaling pathway
    111162516
   04340 Hedgehog signaling pathway
    111162516
   04371 Apelin signaling pathway
    111162516
   04020 Calcium signaling pathway
    111162516
   04024 cAMP signaling pathway
    111162516
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111162516
  09143 Cell growth and death
   04114 Oocyte meiosis
    111162516
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111162516
   04540 Gap junction
    111162516
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111162516
   04062 Chemokine signaling pathway
    111162516
  09152 Endocrine system
   04911 Insulin secretion
    111162516
   04910 Insulin signaling pathway
    111162516
   04922 Glucagon signaling pathway
    111162516
   04923 Regulation of lipolysis in adipocytes
    111162516
   04912 GnRH signaling pathway
    111162516
   04913 Ovarian steroidogenesis
    111162516
   04915 Estrogen signaling pathway
    111162516
   04914 Progesterone-mediated oocyte maturation
    111162516
   04921 Oxytocin signaling pathway
    111162516
   04926 Relaxin signaling pathway
    111162516
   04935 Growth hormone synthesis, secretion and action
    111162516
   04918 Thyroid hormone synthesis
    111162516
   04919 Thyroid hormone signaling pathway
    111162516
   04928 Parathyroid hormone synthesis, secretion and action
    111162516
   04916 Melanogenesis
    111162516
   04924 Renin secretion
    111162516
   04925 Aldosterone synthesis and secretion
    111162516
   04927 Cortisol synthesis and secretion
    111162516
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111162516
   04270 Vascular smooth muscle contraction
    111162516
  09154 Digestive system
   04970 Salivary secretion
    111162516
   04971 Gastric acid secretion
    111162516
   04976 Bile secretion
    111162516
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111162516
   04961 Endocrine and other factor-regulated calcium reabsorption
    111162516
  09156 Nervous system
   04724 Glutamatergic synapse
    111162516
   04727 GABAergic synapse
    111162516
   04725 Cholinergic synapse
    111162516
   04728 Dopaminergic synapse
    111162516
   04726 Serotonergic synapse
    111162516
   04720 Long-term potentiation
    111162516
   04723 Retrograde endocannabinoid signaling
    111162516
  09157 Sensory system
   04740 Olfactory transduction
    111162516
   04742 Taste transduction
    111162516
   04750 Inflammatory mediator regulation of TRP channels
    111162516
  09149 Aging
   04211 Longevity regulating pathway
    111162516
   04213 Longevity regulating pathway - multiple species
    111162516
  09159 Environmental adaptation
   04713 Circadian entrainment
    111162516
   04714 Thermogenesis
    111162516
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162516
   05205 Proteoglycans in cancer
    111162516
   05203 Viral carcinogenesis
    111162516
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111162516
   05020 Prion disease
    111162516
  09165 Substance dependence
   05030 Cocaine addiction
    111162516
   05031 Amphetamine addiction
    111162516
   05032 Morphine addiction
    111162516
   05034 Alcoholism
    111162516
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111162516
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111162516
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111162516
   05163 Human cytomegalovirus infection
    111162516
   05165 Human papillomavirus infection
    111162516
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111162516
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111162516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111162516
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111162516
   03036 Chromosome and associated proteins [BR:elk03036]
    111162516
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111162516
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  PKA family
   111162516
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111162516
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111162516
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 111162516
NCBI-ProteinID: XP_022382691
UniProt: A0A2Y9L9E0
LinkDB
Position
Unknown
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgcagccgccaagaagggcagcgagcaggagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ttggatcagtttgaacgaatcaagaccctcggcacaggctcctttgggcgggtgatgctg
gtgaagcacaaggagaccgggaaccactttgccatgaagatccttgacaaacagaaggtg
gtgaagctgaaacagatcgagcacaccctgaatgagaagcgtatcctgcaggcggtcaac
ttcccgttcctcgtcaaactcgagttctccttcaaggacaactcgaatttatacatggtc
atggagtatgtgcctggcggggagatgttctcgcacctgcggcggatcggaaggttcagt
gaaccgcatgcccgcttctacgcggcccagatcgtcctgaccttcgagtacctgcactca
cttgacctcatctatcgggacctgaagccggagaacctcctcattgaccagcagggctac
atccaggtgacagacttcggtttcgccaagcgtgtaaaaggccgcacctggaccttatgc
gggacccctgagtacttggccccggagatcatcttgagcaaaggctacaacaaggctgtg
gactggtgggccctaggggttctcatctacgagatggccgctggctacccacccttcttc
gctgaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttcccatcc
cacttcagctctgacctgaaggatctgctgcggaacctgctgcaggtggacctcaccaaa
cgctttgggaacctcaagaatggggttaacgatatcaagaaccacaagtggtttgccaca
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaattttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagtttactgagttttag

DBGET integrated database retrieval system