KEGG   Enhydra lutris kenyoni (northern sea otter): 111143470
Entry
111143470         CDS       T05871                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05100  Bacterial invasion of epithelial cells
elk05135  Yersinia infection
elk05142  Chagas disease
elk05146  Amoebiasis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111143470
   04014 Ras signaling pathway
    111143470
   04015 Rap1 signaling pathway
    111143470
   04370 VEGF signaling pathway
    111143470
   04630 JAK-STAT signaling pathway
    111143470
   04668 TNF signaling pathway
    111143470
   04066 HIF-1 signaling pathway
    111143470
   04068 FoxO signaling pathway
    111143470
   04070 Phosphatidylinositol signaling system
    111143470
   04072 Phospholipase D signaling pathway
    111143470
   04071 Sphingolipid signaling pathway
    111143470
   04024 cAMP signaling pathway
    111143470
   04151 PI3K-Akt signaling pathway
    111143470
   04152 AMPK signaling pathway
    111143470
   04150 mTOR signaling pathway
    111143470
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111143470
  09143 Cell growth and death
   04210 Apoptosis
    111143470
   04218 Cellular senescence
    111143470
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111143470
   04550 Signaling pathways regulating pluripotency of stem cells
    111143470
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111143470
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111143470
   04613 Neutrophil extracellular trap formation
    111143470
   04620 Toll-like receptor signaling pathway
    111143470
   04625 C-type lectin receptor signaling pathway
    111143470
   04650 Natural killer cell mediated cytotoxicity
    111143470
   04660 T cell receptor signaling pathway
    111143470
   04662 B cell receptor signaling pathway
    111143470
   04664 Fc epsilon RI signaling pathway
    111143470
   04666 Fc gamma R-mediated phagocytosis
    111143470
   04670 Leukocyte transendothelial migration
    111143470
   04062 Chemokine signaling pathway
    111143470
  09152 Endocrine system
   04910 Insulin signaling pathway
    111143470
   04923 Regulation of lipolysis in adipocytes
    111143470
   04929 GnRH secretion
    111143470
   04915 Estrogen signaling pathway
    111143470
   04914 Progesterone-mediated oocyte maturation
    111143470
   04917 Prolactin signaling pathway
    111143470
   04926 Relaxin signaling pathway
    111143470
   04935 Growth hormone synthesis, secretion and action
    111143470
   04919 Thyroid hormone signaling pathway
    111143470
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111143470
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111143470
  09156 Nervous system
   04725 Cholinergic synapse
    111143470
   04722 Neurotrophin signaling pathway
    111143470
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111143470
  09158 Development and regeneration
   04360 Axon guidance
    111143470
   04380 Osteoclast differentiation
    111143470
  09149 Aging
   04211 Longevity regulating pathway
    111143470
   04213 Longevity regulating pathway - multiple species
    111143470
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143470
   05206 MicroRNAs in cancer
    111143470
   05205 Proteoglycans in cancer
    111143470
   05203 Viral carcinogenesis
    111143470
   05230 Central carbon metabolism in cancer
    111143470
   05231 Choline metabolism in cancer
    111143470
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111143470
  09162 Cancer: specific types
   05210 Colorectal cancer
    111143470
   05212 Pancreatic cancer
    111143470
   05225 Hepatocellular carcinoma
    111143470
   05226 Gastric cancer
    111143470
   05214 Glioma
    111143470
   05221 Acute myeloid leukemia
    111143470
   05220 Chronic myeloid leukemia
    111143470
   05218 Melanoma
    111143470
   05211 Renal cell carcinoma
    111143470
   05215 Prostate cancer
    111143470
   05213 Endometrial cancer
    111143470
   05224 Breast cancer
    111143470
   05222 Small cell lung cancer
    111143470
   05223 Non-small cell lung cancer
    111143470
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111143470
   05017 Spinocerebellar ataxia
    111143470
   05020 Prion disease
    111143470
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111143470
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111143470
   04932 Non-alcoholic fatty liver disease
    111143470
   04931 Insulin resistance
    111143470
   04933 AGE-RAGE signaling pathway in diabetic complications
    111143470
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111143470
   05100 Bacterial invasion of epithelial cells
    111143470
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143470
   05170 Human immunodeficiency virus 1 infection
    111143470
   05161 Hepatitis B
    111143470
   05160 Hepatitis C
    111143470
   05171 Coronavirus disease - COVID-19
    111143470
   05164 Influenza A
    111143470
   05162 Measles
    111143470
   05168 Herpes simplex virus 1 infection
    111143470
   05163 Human cytomegalovirus infection
    111143470
   05167 Kaposi sarcoma-associated herpesvirus infection
    111143470
   05169 Epstein-Barr virus infection
    111143470
   05165 Human papillomavirus infection
    111143470
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111143470
   05142 Chagas disease
    111143470
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111143470
   01524 Platinum drug resistance
    111143470
   01522 Endocrine resistance
    111143470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111143470
Membrane trafficking [BR:elk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111143470
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Mod_r DUF5638 Fez1
Other DBs
NCBI-GeneID: 111143470
NCBI-ProteinID: XP_022352946
UniProt: A0A2Y9IWM8
LinkDB
Position
Unknown
AA seq 507 aa
MGPSQPVRAPRPRGLSSPYRRPRLGWPRPRFPKMFKCSRRTYRQKPQGPTATPAATNPAT
VATDINNTPTTTTSVWILPPQALPPKPPKPMTSAVTNGMKDSSVSLQDAEWYWGDISREE
VNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVV
ELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKE
YDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIE
RIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLV
WLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYG
KPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQ
TSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggggccttctcagcctgtccgtgcccctcggccccggggcctaagctccccctaccgt
aggccaaggctaggctggcctcggcctcgatttccgaagatgttcaagtgtagccgcaga
acgtaccggcagaaaccccaaggtccaactgccacccctgcagccaccaatcctgccact
gtggccacagatatcaacaacactcctaccaccaccaccagtgtgtggatccttccgcca
caagctcttccaccaaagccacctaagccaatgacttcagctgttacaaatggaatgaag
gacagttctgtttctcttcaggatgcagaatggtactggggggatatttcaagggaggag
gttaatgacaagttacgggatatgccagatggtacgttcttggtcagagatgcctcaaca
aaaatgcagggggattatactttgacgttgcggaagggaggcaataataaattaataaag
atctatcatcgagatggtaaatacggcttttctgatcctctgacatttaattctgtggtg
gagctcattaaccactatcatcatgaatctcttgctcagtacaatcccaaacttgatgtg
aagctaatgtacccagtgtccagataccaacaggatcagctggtaaaagaagacaacatt
gatgcagttggtaaaaaactgcaagagtaccactctcagtatcaggaaaagagtaaagag
tatgataggctatatgaggaatataccagaacatcccaggagatacagatgaagaggact
gcaattgaagcttttaatgaaacaattaaaatatttgaagagcaatgtcacacacaagaa
caacatagcaaagaatatattgagcgatttcgcagagaggggaatgaaaaggaaattgaa
cgaattatgatgaattatgacaaattgaaatcacgtcttggtgagattcatgatagcaaa
atgcgtctagagcaggatttgaagaaacaagctttggacaaccgggaaatagataaaaaa
atgaacagtatcaaacctgacctaatccagctgcgcaagatccgagatcagcaccttgtg
tggctcaatcacaaaggagtgaggcagaagcgcctcaatgcctggctgggaatcaagaac
gaggatgctgatgagacctattttatcaatgaggaagatgaaaacctgccccattatgat
gagaaaacctggtttgttgaggatatcaatcgagtacaagcggaggacttgctttatggg
aaacctgatggtgcatttttaattcgtgagagtagcaagaaaggatgttatgcttgctct
gtggttgccgatggggaagtgaagcactgtgtgatctacagcaccgctcggggctacggc
tttgcagagccctacaacctgtacagctccctgaaggagctggtgctccattaccagcag
acatccctcgttcagcacaacgactccctcaatgtcaggcttgcctaccctgtccacgca
cagatgccctccctctgcagataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111143790
Entry
111143790         CDS       T05871                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05100  Bacterial invasion of epithelial cells
elk05135  Yersinia infection
elk05142  Chagas disease
elk05146  Amoebiasis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111143790
   04014 Ras signaling pathway
    111143790
   04015 Rap1 signaling pathway
    111143790
   04370 VEGF signaling pathway
    111143790
   04630 JAK-STAT signaling pathway
    111143790
   04668 TNF signaling pathway
    111143790
   04066 HIF-1 signaling pathway
    111143790
   04068 FoxO signaling pathway
    111143790
   04070 Phosphatidylinositol signaling system
    111143790
   04072 Phospholipase D signaling pathway
    111143790
   04071 Sphingolipid signaling pathway
    111143790
   04024 cAMP signaling pathway
    111143790
   04151 PI3K-Akt signaling pathway
    111143790
   04152 AMPK signaling pathway
    111143790
   04150 mTOR signaling pathway
    111143790
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111143790
  09143 Cell growth and death
   04210 Apoptosis
    111143790
   04218 Cellular senescence
    111143790
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111143790
   04550 Signaling pathways regulating pluripotency of stem cells
    111143790
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111143790
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111143790
   04613 Neutrophil extracellular trap formation
    111143790
   04620 Toll-like receptor signaling pathway
    111143790
   04625 C-type lectin receptor signaling pathway
    111143790
   04650 Natural killer cell mediated cytotoxicity
    111143790
   04660 T cell receptor signaling pathway
    111143790
   04662 B cell receptor signaling pathway
    111143790
   04664 Fc epsilon RI signaling pathway
    111143790
   04666 Fc gamma R-mediated phagocytosis
    111143790
   04670 Leukocyte transendothelial migration
    111143790
   04062 Chemokine signaling pathway
    111143790
  09152 Endocrine system
   04910 Insulin signaling pathway
    111143790
   04923 Regulation of lipolysis in adipocytes
    111143790
   04929 GnRH secretion
    111143790
   04915 Estrogen signaling pathway
    111143790
   04914 Progesterone-mediated oocyte maturation
    111143790
   04917 Prolactin signaling pathway
    111143790
   04926 Relaxin signaling pathway
    111143790
   04935 Growth hormone synthesis, secretion and action
    111143790
   04919 Thyroid hormone signaling pathway
    111143790
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111143790
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111143790
  09156 Nervous system
   04725 Cholinergic synapse
    111143790
   04722 Neurotrophin signaling pathway
    111143790
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111143790
  09158 Development and regeneration
   04360 Axon guidance
    111143790
   04380 Osteoclast differentiation
    111143790
  09149 Aging
   04211 Longevity regulating pathway
    111143790
   04213 Longevity regulating pathway - multiple species
    111143790
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143790
   05206 MicroRNAs in cancer
    111143790
   05205 Proteoglycans in cancer
    111143790
   05203 Viral carcinogenesis
    111143790
   05230 Central carbon metabolism in cancer
    111143790
   05231 Choline metabolism in cancer
    111143790
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111143790
  09162 Cancer: specific types
   05210 Colorectal cancer
    111143790
   05212 Pancreatic cancer
    111143790
   05225 Hepatocellular carcinoma
    111143790
   05226 Gastric cancer
    111143790
   05214 Glioma
    111143790
   05221 Acute myeloid leukemia
    111143790
   05220 Chronic myeloid leukemia
    111143790
   05218 Melanoma
    111143790
   05211 Renal cell carcinoma
    111143790
   05215 Prostate cancer
    111143790
   05213 Endometrial cancer
    111143790
   05224 Breast cancer
    111143790
   05222 Small cell lung cancer
    111143790
   05223 Non-small cell lung cancer
    111143790
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111143790
   05017 Spinocerebellar ataxia
    111143790
   05020 Prion disease
    111143790
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111143790
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111143790
   04932 Non-alcoholic fatty liver disease
    111143790
   04931 Insulin resistance
    111143790
   04933 AGE-RAGE signaling pathway in diabetic complications
    111143790
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111143790
   05100 Bacterial invasion of epithelial cells
    111143790
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143790
   05170 Human immunodeficiency virus 1 infection
    111143790
   05161 Hepatitis B
    111143790
   05160 Hepatitis C
    111143790
   05171 Coronavirus disease - COVID-19
    111143790
   05164 Influenza A
    111143790
   05162 Measles
    111143790
   05168 Herpes simplex virus 1 infection
    111143790
   05163 Human cytomegalovirus infection
    111143790
   05167 Kaposi sarcoma-associated herpesvirus infection
    111143790
   05169 Epstein-Barr virus infection
    111143790
   05165 Human papillomavirus infection
    111143790
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111143790
   05142 Chagas disease
    111143790
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111143790
   01524 Platinum drug resistance
    111143790
   01522 Endocrine resistance
    111143790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111143790
Membrane trafficking [BR:elk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111143790
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 111143790
NCBI-ProteinID: XP_022353378
UniProt: A0A2Y9IXT9
LinkDB
Position
Unknown
AA seq 726 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSESLYRPELPAPRTDWSLSDVEQWDSAALTDGVKGFLLA
LPAPLVTPEAVAEARRALRETAGPVGPALEPPTLPLHRALTLRFLLQHLGGVARRAPAPG
PAVRALGATFGPLLLRAPPPSPPLGGAPEGTESSPDFPALLVEKLLQEHLEEQEVAPPAL
PPKPPKAKPAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQ
GEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLL
YPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIE
AFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKL
EQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETE
DQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVD
GDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPG
PPPPAR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggccggtgccgagggcttccagtaccgtgcactgtacccgttccgccgggagcgtccg
gaggacctggagctgctgccgggcgacgtgctggtggtgagccgggcggccctgcaggtg
ctgggcgtggctgagggcaacgagcgctgcccacagagtgtgggctggatgcctggcctc
aatgagcgcacgcggcaacgaggtgacttccccggcacctacgtcgagttcctgggtcct
gtagccctggcccggcctggccctcgtccacgtggcccccgcccactgcccgccaggccc
cgggatgggccccctgagccaggcctcactctccctgacctgccagagcagttctcccca
cctgatgtggctcccccgatcctggtgaagctggtagaggccattgagcggacaggttta
gacagtgaatccctctacaggcctgagctgcctgccccgcgcacagactggtccctgagc
gacgtggagcagtgggactccgcagccctaacagacggtgtcaagggcttcctgctggcg
ctacccgcgcccctcgtgactcccgaggccgtggccgaggcacgccgggccctgcgggag
accgcggggccagtggggccggcgctggagcccccgacgctgccactgcaccgcgcgctc
acgctgcggttcctgctccagcacctgggcggagtggcccgacgcgcccccgctcctggc
cccgccgtgcgagccctgggcgccaccttcgggccgctgctgctgcgcgcgccgcctccc
tcgccgccgctagggggcgcgcccgaagggactgagtccagccctgacttcccggcgctg
ctggtggagaagttgcttcaggaacatctggaggagcaggaggttgcgcccccagcgctg
cctcctaaaccccccaaagcaaagcctgcccctgcaggcctggccaatgggggaagccca
ccctccctgcaggacgcggagtggtactggggtgacatctccagggaggaggtgaacgag
aaactccgggacacgcctgatggcacctttctggtccgagatgcatctagcaagatccaa
ggggagtacacgctgaccctcaggaaaggcgggaacaacaagctgatcaaagtcttccac
cgcgacgggcactacggcttctcggagcctctcaccttctgctctgttgtggacctcatc
acccactaccgccatgagtcgttggcccagtacaatgccaagctggatacccggctcctc
taccccgtgtccaagtaccagcaggaccagattgtcaaggaggacagtgtggaggcggtg
ggtgcccagctcaaagtctaccaccagcagtaccaggacaagagccgcgagtatgaccag
ctctatgaggagtacacccgcacctcccaggagctgcagatgaagcgcacagctatcgag
gccttcaatgagaccatcaagatctttgaagagcagggccagacgcaagagaagtgtagc
aaggaatatctggagcgcttccgacgtgagggcaatgagaaggagatgcagaggatcctg
ctgaactcagagcggctcaagtctcgcatcgctgagatccacgagagccgcacaaagctg
gagcaggagctgcgggcgcaggcctcagacaaccgggagatcgacaagcgcatgaacagc
ctcaagccagacctcatgcagctgcgcaagatccgagaccagtacctcgtgtggctcact
cagaaaggcgcccggcagaagaaaatcaacgagtggttggggatcaaaaatgagactgag
gaccagtatgcgctgatggaggatgaggacgacctgccccaccatgaggaacgcacgtgg
tatgtgggcaagatcaaccggacacaagccgaggaaatgctgagcggcaagcgggatggc
accttcctcatccgcgagagcagccagcgtggctgctacgcctgctccgtggtggtggac
ggcgacaccaagcactgcgtcatctaccgcacggccacaggcttcggcttcgcggagccc
tacaacctgtacgggtcgctaaaggagctggtgctgcactaccagcacgcctcactcgtg
cagcacaacgacgcgctcacagtcacgctcgcccacccggtgcgcgccccaggccctggg
cccccgccccctgcccgctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111147545
Entry
111147545         CDS       T05871                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00562  Inositol phosphate metabolism
elk01100  Metabolic pathways
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05100  Bacterial invasion of epithelial cells
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05146  Amoebiasis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111147545
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111147545
   04014 Ras signaling pathway
    111147545
   04015 Rap1 signaling pathway
    111147545
   04370 VEGF signaling pathway
    111147545
   04630 JAK-STAT signaling pathway
    111147545
   04668 TNF signaling pathway
    111147545
   04066 HIF-1 signaling pathway
    111147545
   04068 FoxO signaling pathway
    111147545
   04070 Phosphatidylinositol signaling system
    111147545
   04072 Phospholipase D signaling pathway
    111147545
   04071 Sphingolipid signaling pathway
    111147545
   04024 cAMP signaling pathway
    111147545
   04151 PI3K-Akt signaling pathway
    111147545
   04152 AMPK signaling pathway
    111147545
   04150 mTOR signaling pathway
    111147545
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111147545
  09143 Cell growth and death
   04210 Apoptosis
    111147545
   04218 Cellular senescence
    111147545
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111147545
   04550 Signaling pathways regulating pluripotency of stem cells
    111147545
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111147545
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111147545
   04613 Neutrophil extracellular trap formation
    111147545
   04620 Toll-like receptor signaling pathway
    111147545
   04625 C-type lectin receptor signaling pathway
    111147545
   04650 Natural killer cell mediated cytotoxicity
    111147545
   04660 T cell receptor signaling pathway
    111147545
   04662 B cell receptor signaling pathway
    111147545
   04664 Fc epsilon RI signaling pathway
    111147545
   04666 Fc gamma R-mediated phagocytosis
    111147545
   04670 Leukocyte transendothelial migration
    111147545
   04062 Chemokine signaling pathway
    111147545
  09152 Endocrine system
   04910 Insulin signaling pathway
    111147545
   04923 Regulation of lipolysis in adipocytes
    111147545
   04929 GnRH secretion
    111147545
   04915 Estrogen signaling pathway
    111147545
   04914 Progesterone-mediated oocyte maturation
    111147545
   04917 Prolactin signaling pathway
    111147545
   04926 Relaxin signaling pathway
    111147545
   04935 Growth hormone synthesis, secretion and action
    111147545
   04919 Thyroid hormone signaling pathway
    111147545
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111147545
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111147545
  09156 Nervous system
   04725 Cholinergic synapse
    111147545
   04722 Neurotrophin signaling pathway
    111147545
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111147545
  09158 Development and regeneration
   04360 Axon guidance
    111147545
   04380 Osteoclast differentiation
    111147545
  09149 Aging
   04211 Longevity regulating pathway
    111147545
   04213 Longevity regulating pathway - multiple species
    111147545
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111147545
   05206 MicroRNAs in cancer
    111147545
   05205 Proteoglycans in cancer
    111147545
   05203 Viral carcinogenesis
    111147545
   05230 Central carbon metabolism in cancer
    111147545
   05231 Choline metabolism in cancer
    111147545
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111147545
  09162 Cancer: specific types
   05210 Colorectal cancer
    111147545
   05212 Pancreatic cancer
    111147545
   05225 Hepatocellular carcinoma
    111147545
   05226 Gastric cancer
    111147545
   05214 Glioma
    111147545
   05221 Acute myeloid leukemia
    111147545
   05220 Chronic myeloid leukemia
    111147545
   05218 Melanoma
    111147545
   05211 Renal cell carcinoma
    111147545
   05215 Prostate cancer
    111147545
   05213 Endometrial cancer
    111147545
   05224 Breast cancer
    111147545
   05222 Small cell lung cancer
    111147545
   05223 Non-small cell lung cancer
    111147545
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111147545
   05017 Spinocerebellar ataxia
    111147545
   05020 Prion disease
    111147545
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111147545
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111147545
   04932 Non-alcoholic fatty liver disease
    111147545
   04931 Insulin resistance
    111147545
   04933 AGE-RAGE signaling pathway in diabetic complications
    111147545
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111147545
   05135 Yersinia infection
    111147545
   05100 Bacterial invasion of epithelial cells
    111147545
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111147545
   05170 Human immunodeficiency virus 1 infection
    111147545
   05161 Hepatitis B
    111147545
   05160 Hepatitis C
    111147545
   05171 Coronavirus disease - COVID-19
    111147545
   05164 Influenza A
    111147545
   05162 Measles
    111147545
   05168 Herpes simplex virus 1 infection
    111147545
   05163 Human cytomegalovirus infection
    111147545
   05167 Kaposi sarcoma-associated herpesvirus infection
    111147545
   05169 Epstein-Barr virus infection
    111147545
   05165 Human papillomavirus infection
    111147545
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111147545
   05142 Chagas disease
    111147545
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111147545
   01524 Platinum drug resistance
    111147545
   01522 Endocrine resistance
    111147545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111147545
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     111147545
Membrane trafficking [BR:elk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111147545
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 111147545
NCBI-ProteinID: XP_022359347
UniProt: A0A2Y9JE77
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acattaataactataaagcatgaattatttaaagaagcaagaaagtaccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgagaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataagttagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaaccagaagtatgttgctatcatctgaacaactcaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttccttgagaaatatcctctaagtcagtataagtacataagaagctgtataatgctgggg
aggatgcccaatttgatgctcatggctaaagaaagcctttattcccaactgccaatggac
tgtttcacaatgccttcatattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaatcctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggcatc
tatcatggaggagaacccttatgcgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctaaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattatacagatactctagtatctggaaaa
atggctctgaatctgtggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaacaccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaactggtcggtg
tctcgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aacgaattaagagaaaacgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaactgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttagaa
aaatatttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacggtt
agtcagaggtttggccttcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctaaataggcaagttgaggctatggaaaagctcattaacttaactgatatcctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcagatgcgg
cgaccagatttcatggatgctctccaaggttttctatctcctcttaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaagaccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacgtcaagatatgctaacacttcaaataattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatctccgaatgttaccttatggttgtctgtca
attggtgattgtgtgggacttattgaggtggtgcgaaattctcacacgattatgcagatt
cagtgcaaaggtggcctgaaaggcgctctgcagtttaacagccacacactccaccagtgg
ctcaaagacaagaacaaaggagaaatatatgatgctgccattgacctgttcacacgttca
tgtgctggatattgtgtcgctaccttcattctgggcattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgctacaaggcttatctggctatccggcagcacgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaaccgaacaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154641
Entry
111154641         CDS       T05871                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00562  Inositol phosphate metabolism
elk01100  Metabolic pathways
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05100  Bacterial invasion of epithelial cells
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05146  Amoebiasis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111154641
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111154641
   04014 Ras signaling pathway
    111154641
   04015 Rap1 signaling pathway
    111154641
   04370 VEGF signaling pathway
    111154641
   04630 JAK-STAT signaling pathway
    111154641
   04668 TNF signaling pathway
    111154641
   04066 HIF-1 signaling pathway
    111154641
   04068 FoxO signaling pathway
    111154641
   04070 Phosphatidylinositol signaling system
    111154641
   04072 Phospholipase D signaling pathway
    111154641
   04071 Sphingolipid signaling pathway
    111154641
   04024 cAMP signaling pathway
    111154641
   04151 PI3K-Akt signaling pathway
    111154641
   04152 AMPK signaling pathway
    111154641
   04150 mTOR signaling pathway
    111154641
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111154641
  09143 Cell growth and death
   04210 Apoptosis
    111154641
   04218 Cellular senescence
    111154641
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111154641
   04550 Signaling pathways regulating pluripotency of stem cells
    111154641
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111154641
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111154641
   04613 Neutrophil extracellular trap formation
    111154641
   04620 Toll-like receptor signaling pathway
    111154641
   04625 C-type lectin receptor signaling pathway
    111154641
   04650 Natural killer cell mediated cytotoxicity
    111154641
   04660 T cell receptor signaling pathway
    111154641
   04662 B cell receptor signaling pathway
    111154641
   04664 Fc epsilon RI signaling pathway
    111154641
   04666 Fc gamma R-mediated phagocytosis
    111154641
   04670 Leukocyte transendothelial migration
    111154641
   04062 Chemokine signaling pathway
    111154641
  09152 Endocrine system
   04910 Insulin signaling pathway
    111154641
   04923 Regulation of lipolysis in adipocytes
    111154641
   04929 GnRH secretion
    111154641
   04915 Estrogen signaling pathway
    111154641
   04914 Progesterone-mediated oocyte maturation
    111154641
   04917 Prolactin signaling pathway
    111154641
   04926 Relaxin signaling pathway
    111154641
   04935 Growth hormone synthesis, secretion and action
    111154641
   04919 Thyroid hormone signaling pathway
    111154641
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111154641
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111154641
  09156 Nervous system
   04725 Cholinergic synapse
    111154641
   04722 Neurotrophin signaling pathway
    111154641
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111154641
  09158 Development and regeneration
   04360 Axon guidance
    111154641
   04380 Osteoclast differentiation
    111154641
  09149 Aging
   04211 Longevity regulating pathway
    111154641
   04213 Longevity regulating pathway - multiple species
    111154641
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154641
   05206 MicroRNAs in cancer
    111154641
   05205 Proteoglycans in cancer
    111154641
   05203 Viral carcinogenesis
    111154641
   05230 Central carbon metabolism in cancer
    111154641
   05231 Choline metabolism in cancer
    111154641
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111154641
  09162 Cancer: specific types
   05210 Colorectal cancer
    111154641
   05212 Pancreatic cancer
    111154641
   05225 Hepatocellular carcinoma
    111154641
   05226 Gastric cancer
    111154641
   05214 Glioma
    111154641
   05221 Acute myeloid leukemia
    111154641
   05220 Chronic myeloid leukemia
    111154641
   05218 Melanoma
    111154641
   05211 Renal cell carcinoma
    111154641
   05215 Prostate cancer
    111154641
   05213 Endometrial cancer
    111154641
   05224 Breast cancer
    111154641
   05222 Small cell lung cancer
    111154641
   05223 Non-small cell lung cancer
    111154641
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111154641
   05017 Spinocerebellar ataxia
    111154641
   05020 Prion disease
    111154641
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111154641
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111154641
   04932 Non-alcoholic fatty liver disease
    111154641
   04931 Insulin resistance
    111154641
   04933 AGE-RAGE signaling pathway in diabetic complications
    111154641
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111154641
   05135 Yersinia infection
    111154641
   05100 Bacterial invasion of epithelial cells
    111154641
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154641
   05170 Human immunodeficiency virus 1 infection
    111154641
   05161 Hepatitis B
    111154641
   05160 Hepatitis C
    111154641
   05171 Coronavirus disease - COVID-19
    111154641
   05164 Influenza A
    111154641
   05162 Measles
    111154641
   05168 Herpes simplex virus 1 infection
    111154641
   05163 Human cytomegalovirus infection
    111154641
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154641
   05169 Epstein-Barr virus infection
    111154641
   05165 Human papillomavirus infection
    111154641
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111154641
   05142 Chagas disease
    111154641
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111154641
   01524 Platinum drug resistance
    111154641
   01522 Endocrine resistance
    111154641
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111154641
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     111154641
Membrane trafficking [BR:elk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111154641
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 111154641
NCBI-ProteinID: XP_022370104
UniProt: A0A2Y9KF36
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLHDPEVNAFRTKMRQFCEEAAARRRQLGWEAWLQYSFPLQLEPSARGWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSSKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSVPDEKGELLNPAGTVRSNPNTESAAALVICLPEVAP
YPVYYPTLDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHLCLR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDHTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gctgttgacttcctgctgcccacgggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccgctcttccac
atgctcagcgaccccgaggcctacgtgttcacctgcgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcggctctgtgacatccagcccttcctgcccgtgctgcgc
ctggtggcccgagagggggacagagtgaagaagctggtcaactcccagatcagcctcctc
atcggcaaaggcctccatgagttcgactccctgcacgaccccgaggtgaatgcctttcgc
accaagatgcgccagttctgcgaggaagcggcagcgcggcggcggcagctgggctgggag
gcttggctacagtacagcttcccgctgcagctggagccctcggcccggggctggggggcc
ggcaccctgcgggtccccaaccgggccctcctggtcaatgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtctagcaaggacgtgccgctggcgctgatggcctgcgcg
ctccggaagaaggccacggtgttccggcagccgctggtggagcagcccgaggactacacg
ctgcaggtgaacgggaggcacgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgtctacacagcgggctgaccccccacctgaccatggtgcattcctcc
tccatcctcgccatgcgggatgagcagagcgaccccgccccccaagtccagaaaccacgc
accaaaccaccccccattcccatgaagaagccttcctccttgtccctgtggtccctggag
cagcctttctgcgtggagctgattcagggcagcaaagtgaatgccgatgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctccgagcccgtgtggaaacagcggctggagttcgacatcaac
atctgcgacctgcctcgcatggcccgtctctgctttgcactttacgccgtgattgagaag
gcgaagaaggctcgctccaccaagaagaaatccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagaccggtgaatgctgcctatac
atgtggccgtctgtcccagacgagaaaggggagctgctgaaccccgcgggaacagtgcgg
agcaaccccaacacagagagtgctgcggcccttgtcatctgcctccctgaggtggccccc
taccctgtgtactaccccaccctggacaagattctggagctggggcggcacggagagcac
gggcgcttcagtgaggaggagcagctacagctacgggagatcctggagcggcgcgggtcc
ggggagctgtacgagcacgagaaggacctggtgtggaagatgcggcatgaggtccaggag
cgcttcccggaggcgctggcccgcctgctgctggtcaccaagtggaacaagcatgaggat
gtggcccagatgctctacctgctgtgttcctggcccgagctgccggtcctgagcgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctccttcgccatcaagtctctg
cggaagctgacggacgacgagcttttccagtacctgctgcagctggtacaggtgctcaag
tacgaatcctacctcgactgcgagctgaccaagttcctgctggaccgggcgctggccaac
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccctccgtg
gctctgcgcttcggcctcatcatggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggcgaggcgctgagcaagctgaaggccctcaatgacttcgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagttgatgcacctgtgcctgcgc
caggagacctacctggaggccctctcccacctgcagtccccgctggaccccagcacgctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagccgctgtgg
gtgatgtacagcaacgaggaggccggcagcgacggcagcgtgggcatcatcttcaagaac
ggggacgacctccgccaggacatgctgacgcttcagatgatccagctcatggatgttctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctctccaccggggac
cacacgggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctgaac
aaaagcaacatggcggccacggctgccttcaacaaggacgcgctgcttaactggctcaag
tccaagaaccctggggaggccttggatcgcgccatcgaggagttcaccctctcctgtgct
ggctactgtgtggccacttacgtgctgggcatcggtgatcggcacagcgacaacatcatg
atccgtgagaacgggcagctcttccatattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccgttcatcctcacttacgactttgtgcac
gtgatccagcaggggaagaccaacaacagtgagaaatttgaaagattccggggttactgc
gaacgcgcctacaccatcctgcgacgccacgggctgctgttcctccacctctttgccctg
atgcgggccgctggtctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tctctggccttgggaaagacagaggaggaggccctgaagcacttccgggtgaagttcaac
gaagccctgcgggagagctggaagaccaaagtgaactggctggcccacaacgtgtccaag
gacaacaggcaatag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155003
Entry
111155003         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00562  Inositol phosphate metabolism
elk01100  Metabolic pathways
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05100  Bacterial invasion of epithelial cells
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05142  Chagas disease
elk05146  Amoebiasis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111155003
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111155003
   04014 Ras signaling pathway
    111155003
   04015 Rap1 signaling pathway
    111155003
   04370 VEGF signaling pathway
    111155003
   04630 JAK-STAT signaling pathway
    111155003
   04668 TNF signaling pathway
    111155003
   04066 HIF-1 signaling pathway
    111155003
   04068 FoxO signaling pathway
    111155003
   04070 Phosphatidylinositol signaling system
    111155003
   04072 Phospholipase D signaling pathway
    111155003
   04071 Sphingolipid signaling pathway
    111155003
   04024 cAMP signaling pathway
    111155003
   04151 PI3K-Akt signaling pathway
    111155003
   04152 AMPK signaling pathway
    111155003
   04150 mTOR signaling pathway
    111155003
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111155003
  09143 Cell growth and death
   04210 Apoptosis
    111155003
   04218 Cellular senescence
    111155003
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111155003
   04550 Signaling pathways regulating pluripotency of stem cells
    111155003
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111155003
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111155003
   04613 Neutrophil extracellular trap formation
    111155003
   04620 Toll-like receptor signaling pathway
    111155003
   04625 C-type lectin receptor signaling pathway
    111155003
   04650 Natural killer cell mediated cytotoxicity
    111155003
   04660 T cell receptor signaling pathway
    111155003
   04662 B cell receptor signaling pathway
    111155003
   04664 Fc epsilon RI signaling pathway
    111155003
   04666 Fc gamma R-mediated phagocytosis
    111155003
   04670 Leukocyte transendothelial migration
    111155003
   04062 Chemokine signaling pathway
    111155003
  09152 Endocrine system
   04910 Insulin signaling pathway
    111155003
   04923 Regulation of lipolysis in adipocytes
    111155003
   04929 GnRH secretion
    111155003
   04915 Estrogen signaling pathway
    111155003
   04914 Progesterone-mediated oocyte maturation
    111155003
   04917 Prolactin signaling pathway
    111155003
   04926 Relaxin signaling pathway
    111155003
   04935 Growth hormone synthesis, secretion and action
    111155003
   04919 Thyroid hormone signaling pathway
    111155003
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111155003
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111155003
  09156 Nervous system
   04725 Cholinergic synapse
    111155003
   04722 Neurotrophin signaling pathway
    111155003
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111155003
  09158 Development and regeneration
   04360 Axon guidance
    111155003
   04380 Osteoclast differentiation
    111155003
  09149 Aging
   04211 Longevity regulating pathway
    111155003
   04213 Longevity regulating pathway - multiple species
    111155003
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111155003
   05206 MicroRNAs in cancer
    111155003
   05205 Proteoglycans in cancer
    111155003
   05203 Viral carcinogenesis
    111155003
   05230 Central carbon metabolism in cancer
    111155003
   05231 Choline metabolism in cancer
    111155003
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111155003
  09162 Cancer: specific types
   05210 Colorectal cancer
    111155003
   05212 Pancreatic cancer
    111155003
   05225 Hepatocellular carcinoma
    111155003
   05226 Gastric cancer
    111155003
   05214 Glioma
    111155003
   05221 Acute myeloid leukemia
    111155003
   05220 Chronic myeloid leukemia
    111155003
   05218 Melanoma
    111155003
   05211 Renal cell carcinoma
    111155003
   05215 Prostate cancer
    111155003
   05213 Endometrial cancer
    111155003
   05224 Breast cancer
    111155003
   05222 Small cell lung cancer
    111155003
   05223 Non-small cell lung cancer
    111155003
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111155003
   05017 Spinocerebellar ataxia
    111155003
   05020 Prion disease
    111155003
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111155003
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111155003
   04932 Non-alcoholic fatty liver disease
    111155003
   04931 Insulin resistance
    111155003
   04933 AGE-RAGE signaling pathway in diabetic complications
    111155003
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111155003
   05135 Yersinia infection
    111155003
   05100 Bacterial invasion of epithelial cells
    111155003
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111155003
   05170 Human immunodeficiency virus 1 infection
    111155003
   05161 Hepatitis B
    111155003
   05160 Hepatitis C
    111155003
   05171 Coronavirus disease - COVID-19
    111155003
   05164 Influenza A
    111155003
   05162 Measles
    111155003
   05168 Herpes simplex virus 1 infection
    111155003
   05163 Human cytomegalovirus infection
    111155003
   05167 Kaposi sarcoma-associated herpesvirus infection
    111155003
   05169 Epstein-Barr virus infection
    111155003
   05165 Human papillomavirus infection
    111155003
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111155003
   05142 Chagas disease
    111155003
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111155003
   01524 Platinum drug resistance
    111155003
   01522 Endocrine resistance
    111155003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111155003
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     111155003
Membrane trafficking [BR:elk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111155003
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 111155003
NCBI-ProteinID: XP_022370703
UniProt: A0A2Y9KC41
LinkDB
Position
Unknown
AA seq 1070 aa
MCVSFIMPPAMADILDIWAVDSQLASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSVLENLEDKLYGGKLIVAVHFENCQDVFSFQISPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDQPLIQFQYIRNCVMNRTLPHFMLVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKMRIISHVWENNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIRFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcgtcagtttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagttagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatattcagctggaggttcctcgggaagctaccatttcctatattaaacagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagttcttataggaaaaggtctacatgaatttgatgcactg
aaggatcccgaagtgaatgagttccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctaaagcagacatacccaccagaacat
gaaccatcggtccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaaatatctcctaatatgaatcct
atcaaaataaatgaactggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagtccctatgactatgtgttgcaagtaagtgggagagtagaatatgtgtttggtgat
cagccactcattcagttccagtatattcggaactgtgtaatgaacaggaccttgccccat
tttatgcttgtggaatgttgcaagatcaagaagatgtatgagcaggaaatgattgccata
gaggctgccataaatcgaaattcatcaaaccttcctcttcctttaccaccaaagaaaatg
cgaattatttctcatgtttgggaaaataacaaccctttccagattgtcttggttaaggga
aataaacttaacacagaagaaagtgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctctgtaaaaccattgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatataaatacttgtgatctgccacgaatggctcgatta
tgttttgctgtttatgcagttctggataaagtgaaaacaaaaaagtctactaaaactatt
aatccctctaaatatcagaccatccggaaatctgggaaagtgcattatcctgtagcatgg
gtgaatacgatggtttttgactttaaaggacagttgagatctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcagattcccagaaaataaaaaa
caaccttattattatcctcccttcgataagataattgagaaggcagctgagattgcaagc
agtgacagtgccaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactaaaagaa
atcttggacagggatcccttgtctcaattgtgtgagaatgaaatggatcttatttggact
ctgcggcaagattgcagagagaatttcccacagtcactgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggcgttagagcttctggatttcaactatccagatcagtacgtgcga
gaatatgctgtgggctgcctgcgacagatgagtgatgaagagctctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcactggctaatcggaggatagggcagtttctcttttggcaccttaggtca
gaagtgcatattcctgctgtctcagtacaatttggtgttatccttgaagcatactgccgg
ggaagtgttgggcacatgaaagtgctttccaagcaggttgaagcactcaataagttaaaa
actttaaatagcttaatcaaactgaatgcaatgaagctaaacagagccaaagggaaggag
gccatgcatacttgtttaaaacagaatgcttaccgggaagccctttctgacctgcagtcg
cctctgaatccatgtgttatcctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcctttgtggctcgtttacaacaacaaagtgtttggtgaagattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaagatatgttgacactccaaatgctg
cgcttgatggatttactttggaaagaagctggtttggatcttcggatgctgccttatggc
tgcttagcgacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctagaccgagccattgaggag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgataga
catagtgacaacattatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggaacgggtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagagaagtttggc
cgcttccgccagtgttgtgaggatgcatatctgattttacgacggcacgggaatctcttc
atcactctttttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155224
Entry
111155224         CDS       T05871                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04611  Platelet activation
elk04613  Neutrophil extracellular trap formation
elk04620  Toll-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04926  Relaxin signaling pathway
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04973  Carbohydrate digestion and absorption
elk05010  Alzheimer disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05100  Bacterial invasion of epithelial cells
elk05135  Yersinia infection
elk05142  Chagas disease
elk05146  Amoebiasis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111155224
   04014 Ras signaling pathway
    111155224
   04015 Rap1 signaling pathway
    111155224
   04370 VEGF signaling pathway
    111155224
   04630 JAK-STAT signaling pathway
    111155224
   04668 TNF signaling pathway
    111155224
   04066 HIF-1 signaling pathway
    111155224
   04068 FoxO signaling pathway
    111155224
   04070 Phosphatidylinositol signaling system
    111155224
   04072 Phospholipase D signaling pathway
    111155224
   04071 Sphingolipid signaling pathway
    111155224
   04024 cAMP signaling pathway
    111155224
   04151 PI3K-Akt signaling pathway
    111155224
   04152 AMPK signaling pathway
    111155224
   04150 mTOR signaling pathway
    111155224
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111155224
  09143 Cell growth and death
   04210 Apoptosis
    111155224
   04218 Cellular senescence
    111155224
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111155224
   04550 Signaling pathways regulating pluripotency of stem cells
    111155224
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111155224
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111155224
   04613 Neutrophil extracellular trap formation
    111155224
   04620 Toll-like receptor signaling pathway
    111155224
   04625 C-type lectin receptor signaling pathway
    111155224
   04650 Natural killer cell mediated cytotoxicity
    111155224
   04660 T cell receptor signaling pathway
    111155224
   04662 B cell receptor signaling pathway
    111155224
   04664 Fc epsilon RI signaling pathway
    111155224
   04666 Fc gamma R-mediated phagocytosis
    111155224
   04670 Leukocyte transendothelial migration
    111155224
   04062 Chemokine signaling pathway
    111155224
  09152 Endocrine system
   04910 Insulin signaling pathway
    111155224
   04923 Regulation of lipolysis in adipocytes
    111155224
   04929 GnRH secretion
    111155224
   04915 Estrogen signaling pathway
    111155224
   04914 Progesterone-mediated oocyte maturation
    111155224
   04917 Prolactin signaling pathway
    111155224
   04926 Relaxin signaling pathway
    111155224
   04935 Growth hormone synthesis, secretion and action
    111155224
   04919 Thyroid hormone signaling pathway
    111155224
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111155224
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111155224
  09156 Nervous system
   04725 Cholinergic synapse
    111155224
   04722 Neurotrophin signaling pathway
    111155224
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111155224
  09158 Development and regeneration
   04360 Axon guidance
    111155224
   04380 Osteoclast differentiation
    111155224
  09149 Aging
   04211 Longevity regulating pathway
    111155224
   04213 Longevity regulating pathway - multiple species
    111155224
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111155224
   05206 MicroRNAs in cancer
    111155224
   05205 Proteoglycans in cancer
    111155224
   05203 Viral carcinogenesis
    111155224
   05230 Central carbon metabolism in cancer
    111155224
   05231 Choline metabolism in cancer
    111155224
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111155224
  09162 Cancer: specific types
   05210 Colorectal cancer
    111155224
   05212 Pancreatic cancer
    111155224
   05225 Hepatocellular carcinoma
    111155224
   05226 Gastric cancer
    111155224
   05214 Glioma
    111155224
   05221 Acute myeloid leukemia
    111155224
   05220 Chronic myeloid leukemia
    111155224
   05218 Melanoma
    111155224
   05211 Renal cell carcinoma
    111155224
   05215 Prostate cancer
    111155224
   05213 Endometrial cancer
    111155224
   05224 Breast cancer
    111155224
   05222 Small cell lung cancer
    111155224
   05223 Non-small cell lung cancer
    111155224
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111155224
   05017 Spinocerebellar ataxia
    111155224
   05020 Prion disease
    111155224
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111155224
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111155224
   04932 Non-alcoholic fatty liver disease
    111155224
   04931 Insulin resistance
    111155224
   04933 AGE-RAGE signaling pathway in diabetic complications
    111155224
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111155224
   05100 Bacterial invasion of epithelial cells
    111155224
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111155224
   05170 Human immunodeficiency virus 1 infection
    111155224
   05161 Hepatitis B
    111155224
   05160 Hepatitis C
    111155224
   05171 Coronavirus disease - COVID-19
    111155224
   05164 Influenza A
    111155224
   05162 Measles
    111155224
   05168 Herpes simplex virus 1 infection
    111155224
   05163 Human cytomegalovirus infection
    111155224
   05167 Kaposi sarcoma-associated herpesvirus infection
    111155224
   05169 Epstein-Barr virus infection
    111155224
   05165 Human papillomavirus infection
    111155224
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111155224
   05142 Chagas disease
    111155224
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111155224
   01524 Platinum drug resistance
    111155224
   01522 Endocrine resistance
    111155224
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111155224
Membrane trafficking [BR:elk04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    111155224
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 AAA_13 DUF4201 SH3_2 Laminin_I Mod_r Lant_dehydr_C PI_PP_I FNIP_M
Other DBs
NCBI-GeneID: 111155224
NCBI-ProteinID: XP_022371045
UniProt: A0A2Y9KPA9
LinkDB
Position
Unknown
AA seq 725 aa
MSAEGYQYRALYDYKKERDEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKAEADSEQQQALALPDLA
EQFAPPDIAPPLLVKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASMDLEMIDV
QVLGDAFKRYLMDLPNPVIPVAVYNEMIYLAQEVQSSEDYIQLLKKLIRAPNIPHQYWLT
LQYLLKHFFKLCQTSSKNLLSARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTSVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgagcattgtatgattacaaaaaggaacgggatgaa
gatattgacttgcacttgggtgatgtcttgactgtgaataaagggtccttagtagctctt
ggattcagtgacggacaggaagccaggcctgaagaaatcggctggttaaatggttataat
gaaaccacgggggaaagaggggactttccgggaacttatgttgaatatattggaaggaaa
agaatctcgcctcccacaccaaagccccgaccacctcgaccccttcctgttgcaccaggt
tcttcgaaagctgaagcagatagtgaacaacagcaagctttggctcttccagatctcgcc
gagcagtttgcccctcccgacattgctccgcctcttctcgtgaagctcctggaagccatt
gaaaagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccggcc
gaattgcgacagcttcttgattgtgatgccgcctccatggacttggaaatgatcgatgtg
caagttttgggagacgctttcaaacgctatcttatggacttaccgaatcctgtcattcca
gtagccgtttacaatgaaatgatttatttagcccaagaagtacaaagctctgaggactac
atccagctgttgaagaagctcattagggcacctaacatacctcatcagtattggctgacg
cttcagtatttgctaaaacatttcttcaagctctgtcagacctccagcaagaatctcctg
agtgcgagagtgctctctgaacttttcagccctctgcttttcagattcccagcagccagc
tctgagaatactgaacacctcattaaagttatagaaattttaatctcaacggagtggaat
gagcgacagcctgcaccagcattgcctcctaaaccaccaaaacccactagtgtagccaac
aacggtatgaataacaatatgtccttacaagatgctgagtggtactggggagatatctca
agggaagaagtgaatgaaaaacttcgagatacagctgatgggacctttttggtacgagac
gcatctactaaaatgcatggggattatactcttacactaaggaaaggaggaaataacaaa
ttaatcaaaatatttcaccgagatgggaaatacggcttctctgacccactgaccttcaac
tctgtggttgaactaataaaccactaccggaatgagtctctagctcagtataatcccaaa
ctggacgtgaaattactttatccagtgtccaaataccaacaggatcaagttgtcaaagaa
gataatattgaagctgtagggaaaaaattacatgagtataacactcaatttcaagaaaaa
agccgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccaaatg
aaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaa
agccaggaacggtacagcaaagaatacatagaaaaatttaaacgcgaaggcaatgagaaa
gaaatacaaaggattatgcataattatgagaagttaaagtcccgaatcagtgaaattgtg
gacagtagaaggagactggaggaagacctgaagaagcaggcagctgagtaccgggagatt
gacaaacgcatgaacagcattaaaccagacctcattcagctgagaaagacaagagaccaa
tacttgatgtggttgactcagaaaggtgttcggcagaagaagctgaatgagtggctgggc
aatgaaaatacggaagaccaatattcgctggtggaagatgatgaggatttgccacaccac
gatgagaagacctggaacgtgggcagcagcaacaggaacaaagctgagaacctactccga
gggaagcgagacggcaccttcctggtccgggagagcagcaaacagggctgctacgcctgc
tctgtcgtggtggacggcgaggtcaagcattgtgtcatcaacaaaacggccaccggctat
ggcttcgccgaaccctataacttgtacagctccctgaaagaactggtgctacattaccaa
cacacgtccctcgtgcagcacaatgactctctcaacgtcacactagcctacccggtatac
gcacagcagaggcgatga

DBGET integrated database retrieval system