KEGG   Enhydra lutris kenyoni (northern sea otter): 111143767
Entry
111143767         CDS       T05871                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04390  Hippo signaling pathway
elk04392  Hippo signaling pathway - multiple species
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05219  Bladder cancer
elk05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111143767
   04390 Hippo signaling pathway
    111143767
   04392 Hippo signaling pathway - multiple species
    111143767
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143767
   05206 MicroRNAs in cancer
    111143767
  09162 Cancer: specific types
   05219 Bladder cancer
    111143767
   05223 Non-small cell lung cancer
    111143767
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 111143767
NCBI-ProteinID: XP_022353320
UniProt: A0A2Y9J5T8
LinkDB
Position
Unknown
AA seq 344 aa
MSTEPELIELRELEPARRAGPGRTRLERANALRIAPGTARNPARQLGAGRGHHFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPALELD
TNVDEPVEWETPDLSQAEVEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGTGRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLSDDEQPLQLRLLAGPSEKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtccacggaacctgaactcattgaactgagggaattggaacccgcgcggcgcgccggc
cccggccgcacccggctggagcgcgccaacgcgctgcgtatcgcgcccggcaccgcgcgc
aatcccgcacggcaactgggcgcgggccgcggccaccacttccagcccgcggggcccgcc
acgcacacgtggtgcgacctctgcggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcgcctctctgcagattgcaagttcacatgccactaccgttgccgcgctctt
gtctgcctggactgctgcgggccccgggacctgggctgggaacctgcgctggagctggac
acgaacgtggacgagcctgtggagtgggaaacacctgacctttctcaggctgaggttgaa
cagaagatcaaggagtacaatagccagatcaacagcaacctcttcatgagcctgaacaag
gatggctcctacacaggcttcatcaaggttcaactgaagctggtacgccctgtctcagtg
ccctccagcaagaagccaccctccttgcaggatgccaggaggggcacagggcggggcaca
gctgtgaggcgccgtacctccttctacctgcccaaggatgctgtcaagcacctgcatgtg
ttgtcacgcacacgggcacgtgaggtcattgaggccctacttcgcaaattcttggtggtg
gatgacccccgcaagtttgcactctttgagcgggctgaacgccatggccaagtgtacctc
cggaagctgtcggatgacgagcagcccctgcagctccggctccttgcagggcccagcgag
aaggccctaagctttgtcctcaaggagaatgactctggggaggtgaattgggatgccttc
agcatgcccgaactacacaacttcctgcgcatcttacagcgggaggaagaggaacacctg
cgccagatcctgcaaaagtactcctattgccgtcagaagatccaggaggccctgcacgcc
tgccccctggggtga

DBGET integrated database retrieval system