KEGG   Enhydra lutris kenyoni (northern sea otter): 111143981
Entry
111143981         CDS       T05871                                 

Definition
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04062  Chemokine signaling pathway
elk04144  Endocytosis
elk05145  Toxoplasmosis
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111143981
   04061 Viral protein interaction with cytokine and cytokine receptor
    111143981
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111143981
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111143981
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111143981
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111143981
   05163 Human cytomegalovirus infection
    111143981
   05167 Kaposi sarcoma-associated herpesvirus infection
    111143981
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111143981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:elk04030]
    111143981
   04050 Cytokine receptors [BR:elk04050]
    111143981
   04090 CD molecules [BR:elk04090]
    111143981
G protein-coupled receptors [BR:elk04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    111143981
Cytokine receptors [BR:elk04050]
 Chemokine receptors
  CC Chemokine
   111143981
CD molecules [BR:elk04090]
 Proteins
  111143981
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srab DUF5073 PRIMA1
Other DBs
NCBI-GeneID: 111143981
NCBI-ProteinID: XP_022353744
UniProt: A0A2Y9J244
LinkDB
Position
Unknown
AA seq 352 aa
MNDPTPTPYYDIDYGMSEPCQKTDVRQIAARLLPPLYSLVFVFGFVGNMLVIFILINCKR
LKSMTDIYLLNLAISDLLFLLTIPFWAQYAADQWVFGNRLCQILTGLYYIGFYTGIFFII
LLTIDRYLAIVHAVFAIKARTVTFGVVTSGVTWVVAVFTSLPGIIFTRSQKERSRLTCSP
HFPPTHYHFWKNFLTLKMTILGLVLPLLVMVVCYSAILKTLLRCRNEKKRHKAVRLIFVI
VIVYFLFWAPYNIVLLLSTFQESFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLKFFRKHIARRFCKHCPVFLGDVSDRASSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaatgaccccacgccgactccatactatgacattgattacgggatgtcagagccctgt
cagaagactgacgtgagacaaatcgcagccagacttcttcctccgctctactctctggtg
ttcgtctttggtttcgtgggtaacatgctggtcatcttcatcctcatcaactgcaaaagg
ctgaagagcatgactgacatctacctgctcaatctggccatctctgacctgctcttcctt
ctcaccatccccttctgggcccagtacgccgcagaccagtgggtctttggaaataggctg
tgtcagattttgacagggctctactacataggcttctacacaggcatcttcttcatcatc
ctcctgaccattgacaggtacctggcgatcgtccacgccgtgtttgccataaaggccagg
acagtcacctttggggtggtgacgagcggggtcacctgggtggtggccgtgttcacctct
ctccccgggatcatcttcaccagatcccagaaggagaggtctcgcctgacctgcagccct
catttcccacccactcattaccatttctggaagaacttcctgacgttaaagatgaccatc
ttgggtctggtcctgcccctgctcgtcatggtcgtctgctactcggccatcctcaagacc
ctgcttcggtgccgaaacgaaaagaagaggcacaaggcggtgaggctcattttcgtgatt
gtgattgtttactttcttttctgggctccctacaacatcgtgcttctcctgagcaccttc
caggagtccttcggcctgaataattgcagcagctccaacaggctggaccaagccatgcag
gtgacggagacccttgggatgacgcactgttgcatcaaccccatcatctacgccttcgtg
ggggagaagttcagaaactacctcttaaagttcttccgaaagcacatcgccagacgcttc
tgcaaacactgccccgtcttcctgggagacgtgtccgacagggcaagctcggtttacact
cgatccaccggggagcaggagatctctgtcggcttatga

DBGET integrated database retrieval system