KEGG   Enhydra lutris kenyoni (northern sea otter): 111144005
Entry
111144005         CDS       T05871                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04114  Oocyte meiosis
elk04140  Autophagy - animal
elk04210  Apoptosis
elk04218  Cellular senescence
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111144005
   04020 Calcium signaling pathway
    111144005
   04070 Phosphatidylinositol signaling system
    111144005
   04022 cGMP-PKG signaling pathway
    111144005
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111144005
  09143 Cell growth and death
   04114 Oocyte meiosis
    111144005
   04210 Apoptosis
    111144005
   04218 Cellular senescence
    111144005
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111144005
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111144005
   04621 NOD-like receptor signaling pathway
    111144005
   04625 C-type lectin receptor signaling pathway
    111144005
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111144005
   04929 GnRH secretion
    111144005
   04912 GnRH signaling pathway
    111144005
   04915 Estrogen signaling pathway
    111144005
   04921 Oxytocin signaling pathway
    111144005
   04935 Growth hormone synthesis, secretion and action
    111144005
   04918 Thyroid hormone synthesis
    111144005
   04928 Parathyroid hormone synthesis, secretion and action
    111144005
   04924 Renin secretion
    111144005
   04925 Aldosterone synthesis and secretion
    111144005
   04927 Cortisol synthesis and secretion
    111144005
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111144005
  09154 Digestive system
   04970 Salivary secretion
    111144005
   04971 Gastric acid secretion
    111144005
   04972 Pancreatic secretion
    111144005
  09156 Nervous system
   04724 Glutamatergic synapse
    111144005
   04725 Cholinergic synapse
    111144005
   04728 Dopaminergic synapse
    111144005
   04726 Serotonergic synapse
    111144005
   04720 Long-term potentiation
    111144005
   04730 Long-term depression
    111144005
   04723 Retrograde endocannabinoid signaling
    111144005
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111144005
  09159 Environmental adaptation
   04713 Circadian entrainment
    111144005
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111144005
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111144005
   05012 Parkinson disease
    111144005
   05016 Huntington disease
    111144005
   05017 Spinocerebellar ataxia
    111144005
   05020 Prion disease
    111144005
   05022 Pathways of neurodegeneration - multiple diseases
    111144005
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111144005
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111144005
   05163 Human cytomegalovirus infection
    111144005
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144005
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111144005
Ion channels [BR:elk04040]
 Ligand-gated channels
  IP3 receptor
   111144005
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 111144005
NCBI-ProteinID: XP_022353770
UniProt: A0A2Y9J7B5
LinkDB
Position
Unknown
AA seq 2709 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSSKEIRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEG
PSNVPGTLDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EAMDGASGENEHKKTEDGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMNWRLTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSG
SSSTSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQH
SFFCRLTEDKKSERFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKA
KEPSTQITEEVRDQLLEASAATRKAFSTFRREADPDDHYQSGEGTQATADKTKDELEMSA
VITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLL
GLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKR
MDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGEN
GEDGAASPRNVGHNIYILAHQLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRL
DRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLR
AQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISL
AIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTR
GYRAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSI
ILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETALPEAGESLASEFLYSDVCRVEP
GENCSSPAPKEELVLAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEP
LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKF
DNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAM
SLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPH
MNVNPQQPA
NT seq 8130 nt   +upstreamnt  +downstreamnt
atgtctgacaagatgtctagtttcctacatattggagacatttgttctctgtacgcggaa
ggatcgacaaatggatttattagcaccttgggtctggttgacgatcgctgtgttgtccag
ccagaagctggggaccttaataatccacccaagaaattcagagattgcctctttaagcta
tgtcccatgaatcgctactctgcccagaagcagttctggaaagctgccaagccaggggcc
aacagcacaacagatgccgtattgctcaacaaattgcaccatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccaatatggcaacgtg
atccagctcctgcatttgaaaagtaataaatacctaactgtgaataagaggcttccggct
ctgctggagaagaacgccatgagagtgactttggacgaggctggaaatgaagggtcctgg
ttttatattcagccgttttacaagctgcgatccatcggagacagcgtggtcattggtgac
aaggttgtactgaaccccgtcaatgctggccagcccctacatgccagcagccatcagctg
gtggataacccgggctgcaacgaggtcaattctgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgacaacaaagatgacatcctgaaggggggtgatgtggta
aggctgttccatgcagagcaggagaagtttcttacctgcgatgagcacaggaagaaacag
catgtcttcctgagaaccaccggccggcagtcggccacatctgccacgagttcaaaagcc
ctgtgggaagtggaggtagttcaacatgacccgtgtcggggcggagcaggatattggaac
agcctcttccgtttcaagcatcttgctacagggcattacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgatcaggacgcctct
cgaagcaggttgcgaaatgcccaagaaaagatggtgtactccctagtttctgtgcctgaa
ggcaacgacatctcctccatttttgagctagaccccaccactctccgtggaggtgatagc
cttgttccaagaaactcctatgtccggctcagacacctgtgcactaatacctgggttcac
agcacaaatatccccatcgacaaggaagaagagaaacccgtgatgctgaaaattggcact
tcccctgtgaaagaggataaggaagcatttgccatagttccagtttcccctgctgaggtt
cgggacctggattttgccaatgatgccagcaaagtgctgggttccatagctgggaagctg
gagaagggcaccatcacccagaatgaaagaaggtctgtaaccaagctgctggaagacttg
gtttattttgtcaccggtggcactaactctggtcaagatgtacttgaagtggtcttctcc
aagcctaacagagaacggcagaagctgatgagagaacagaatattctcaagcagatcttc
aagctgttacaagcaccattcacagactgtggcgatggccccatgctgcggctggaggag
cttggggaccagcggcacgcccctttccgacatatctgccggctctgctacagggtcctg
agacactcccagcaagactacaggaaaaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggccgaagacaccatcaccgccttgcttcac
aataaccgaaaactcctggaaaaacacatcaccgccgctgagatcgacacatttgtcagt
ctggtgcggaagaacagggagcccagattcttagattatctctctgacctctgtgtgtcc
atgaacaaatcgatcccagtgacccaggaactgatatgtaaagccgtgctgaatccaacc
aatgccgacatcctgattgagaccaagttggttctttctcgttttgaatttgagggcgtt
tccactggagagaatgctctggaggcaggagaagatgaagaggaggtgtggctcttctgg
agggacagcagcaaggagattcgcagcaagagtgtcagggaactggcacaggatgccaaa
gaaggacaaaaggaagaccgagacgttctcagctactacaggtatcagttgaacctcttt
gctaggatgtgtctggaccgccaatacctggccatcaatgaaatatcaggccagctggat
gttgatctcattctccgctgcatgtctgacgagaacctgccctatgacctgagggcgtcc
ttctgccgtcttatgcttcatatgcacgtggaccgagatccccaggaacaagtcacgcct
gtgaaatacgcccgcctgtggtctgagattccctcagagatcgccattgacgactatgac
agtagtggaacttctaaagatgaaattaaggagaggtttgcacaaaccatggaatttgtg
gaggagtatttaagagatgtggtttgtcagaggtttcctttctctgataaggagaaaaat
aagcttacctttgaggttgtaaatttagcgaggaatctcatatactttggtttctacaac
ttctctgaccttctccgattaaccaaaatactcctggccatactggactgcgtgcacgtg
acgaccattttccccattagcaagatggcaaaaggagaagagaataaaggcagtaacgta
atgcggtccatccatggggtcggagagctgatgacccaggtggtgctccggggaggaggc
tttttacccatgactcccatggctgctgcccctgagggcaacgtgaagcaggcagagcca
gagaaggaggacatcatggtcatggacaccaagttgaagatcatcgaaatacttcagttt
attttgaatgtgaggttggattataggatctcctgcctcctgtgtatatttaagcgagag
tttgatgaaagcaattcccagacttcggaaacatcctccggaaacagcagccaagagggg
ccaagtaacgtaccaggtactcttgactttgaacacattgaagagcaagcagaaggcatc
tttggaggaagtgaggagaatacccccctggacttggacgaccacggcggcagaaccttc
ctccgagtcttgctgcatttgacgatgcacgactacccacccctggtctcgggagccctg
cagctcctcttccggcacttcagtcagaggcaggaggtcctgcaggccttcaaacaggtc
cagctgcttgttaccagccaagatgtggacaactacaaacagatcaaacaagacttggac
cagctgagatccatcgtggaaaagtcggagctctgggtgtacaaagggcagggccctgat
gaggccatggacggtgcctctggtgaaaatgaacataagaaaacagaggacgggaataac
aagtcacaaaagcatgagagcaccagcagctacaactacagggtggtaaaagagattctg
atccgcctcagcaaactctgtgtccaggagagtgcatccgtgaggaaaagcaggaagcag
cagcagcggcttctacggaacatgggcgcgcacgccgtggtgctggagctgctgcagatc
ccctacgagaaggctgaagataccaagatgcaggagataatgaggctggctcacgaattc
ctacagaatttctgtgcaggcaaccagcagaatcaagccttgctacacaaacacataaac
ctgtttctcaacccagggatcctggaggcggtcaccatgcagcacatcttcatgaacaat
ttccagctctgcagtgagatcaacgagcgggttgtccagcattttgttcattgcattgag
acccacggtcgaaacgtccagtacataaaattcttgcagacgatcgtcaaggcagaaggg
aaattcatcaaaaagtgccaagacatggtcatggctgagctcgttaattcgggagaagac
gtcctcgtgttctacaacgacagagcctctttccagaccctgatccagatgatgaggtca
gagcgggaccggatggacgagaacagccctcttatgtatcacatccacctggtggagctc
ttggccgtgtgcactgagggcaagaacgtctacacggagataaagtgcaactccctgctg
ccgctggatgacatcgtccgcgtcgtgacccacgaggactgcatccccgaggttaaaatt
gcatacattaacttccttaatcactgctatgtggatacggaggtggaaatgaaggagatt
tacaccagcaatcacatgtggaaattgtttgagaatttcctcgtggacatctgcagggcc
tgtaacaacaccagtgacaggaaacatgcagactccattttggagaagtatgttactgaa
attgtcatgagtatcgtcaccactttcttcagttctcccttctcggaccagagcacgacg
ctgcagactcgccagccggtctttgtgcaactgctgcaaggtgtgttcagggtttaccac
tgcaactggttaatgccgagccaaaaagcctccgtggagagctgtatccgggtgctctct
gatgtagctaagagccgggccatcgctattcctgtggacctggacagccaagtcaacaac
ctctttctgaagtcccacaacatcgtacagaaaactgccatgaactggcggctgactgcc
cgcaatgcggctcgcagagactctgttctggcggcttctagagactaccggaatatcatt
gagagattgcaggacatcgtctcggccctggaggaccgtctaaggcccctggtccaggca
gagttatctgtgctcgtggatgtgctccacagacctgagctgcttttcccagagaacaca
gatgccaggagaaagtgtgaaagtggtggcttcatttgcaagttaataaagcatactaaa
cagttgctagaggagaatgaggaaaaactctgcattaaggtcctacagaccctccgagaa
atgatgaccaaagatagaggctatggagaaaagggtgaggcgctcaggcaaattttggtc
aaccgttactatggaaacatcagaccttcaggaagaagagaaagcctcaccagctttggc
aatggcccgctgtcaccaggaggacccagcaagcctgggggaggagggggaggctctggg
tccagttccacgagcaggggtgagatgagcctggctgaggttcagtgccacctcgacaag
gagggtgcctccaatctggtcattgacctcatcatgaacgcatccagtgaccgagtgttt
catgaaagcattctcttggccatcgccctcctggaaggaggcaacaccaccatacagcac
tcctttttctgccggttaacagaagacaagaagtcagaaagattcttcaaagtcttctat
gaccgaatgaaggtggcccagcaggaaatcaaagcaacagtgaccgtgaacaccagtgac
ttggggaataaaaagaaagatgatgaggtagacagggatgccccatcccggaaaaaagcc
aaagagccctcaacacaaataacggaagaggtccgagatcagctcctggaggcctctgct
gccaccaggaaagccttcagcaccttccggagggaggctgaccccgacgaccactaccag
tctggggaaggcacccaggccacagcagacaagaccaaggacgagctggagatgagcgcg
gtcatcaccatcatgcagcccatcctccggttccttcagctcctgtgcgaaaaccacaac
cgggacctgcagaacttccttcgttgccaaaataacaagaccaactacaatttggtgtgt
gagacactgcagttcctggactgtatttgtggaagcactactggaggtcttggtcttctc
gggctctatataaatgaaaagaacgtcgccctcatcaaccaaaccctggaaagtctgacc
gaatactgtcaaggaccatgccatgagaaccagaactgcatagccacccatgaatccaac
ggcattgacatcatcacagccctgatccttaatgacatcaatcctttgggaaagaagagg
atggaccttgtattagaactgaagaacaatgcttccaagttgctgctggccatcatggag
agcaggcacgacagcgagaacgcagagaggatcctttataacatgaggccgaaggaactg
gtggaagtgatcaagaaagcctacatgcaaggtgaggtggaatttgaggatggagagaat
ggcgaggacggagctgcctcccccaggaacgtgggacacaacatctacatactggctcat
cagttggctcggcataacaaagaacttcagaccatgctgaaacctggaggccaagtcgat
ggggacgaagctctggagttttatgccaagcacacagcccagatagagatcgtcagatta
gaccgaaccatggaacagattgtgttccctgtgcccagcatatgtgaattcctaaccaag
gagtcgaaactgcggatatactacactaccgagagggacgagcaaggcagcaagatcaat
gacttcttcctgcggtccgaggacctcttcaatgaaatgaactggcagaagaaactgcga
gcccagcccgttctgtattggtgtgcccgaaacatgtctttctggagcagcatttcattt
aacttggccgtcctgatgaacctgcttgtggcgtttttctacccatttaaaggagtccga
ggaggaacactggagccacactggtcaggactgctgtggacagccatgctcatctctctg
gccattgtcattgccctccccaagccccatggcatccgggccttaattgcttccacaatt
ctccggttgatattttcggttggattacaacccacgttgtttcttctgggagctttcaat
gtctgcaataaaatcatctttctaatgagctttgtgggcaactgtggaacattcaccaga
ggctaccgagccatggttctggatgtcgagttcctttaccatttgttgtatctgctgatc
tgtgccatgggcctcttcgtccacgagttcttctacagtctgctgctttttgatttggta
tacagagaagagactctgcttaatgtcattaaaagtgtcactcgcaatggacggtccatc
atcttgacagcagttctggctttgatcctggtttacctgttctcgatagtgggctatctt
ttcttcaaagatgattttatcttggaagtagataggttgcccaatgaaaccgctcttcca
gaagccggagagagtttggcaagcgagttcctatactctgacgtgtgtagggtggagcct
ggggaaaactgctcctctccggcacccaaagaagagctggtccttgcggaagagacggaa
caagacaaagagcacacgtgtgagacgctgttgatgtgcatcgtcacggtgctgagtcac
gggctgaggagcgggggcggagtaggagacgtgctcaggaagccatccaaagaggagccc
ctctttgccgctagagtgatctatgacctcttgttcttcttcatggtcatcatcatcgtc
cttaatctgatttttggggtcatcatcgacacctttgctgacctgaggagcgagaagcag
aagaaggaggagatcttaaagaccacgtgctttatctgcggcttggagagagacaagttc
gacaacaagactgtcacctttgaagagcacatcaaggaagaacacaacatgtggcactat
ctgtgcttcatcgtgctggtgaaagtgaaggactccacggagtacaccgggcccgagagc
tacgtggcagaaatgatcaaggaaagaaaccttgactggttccccaggatgagagccatg
tccttggtcagcagtgactctgaaggagagcagaatgagctgaggaacctgcaggagaag
ctggagtccaccatgaagctggtcactaacctttccggccagctgtcagaattaaaggat
cagatgacagaacaaaggaagcagaaacaaagaattggtcttctaggacatcctcctcat
atgaatgtcaacccacagcaaccagcataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152507
Entry
111152507         CDS       T05871                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04114  Oocyte meiosis
elk04210  Apoptosis
elk04218  Cellular senescence
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111152507
   04020 Calcium signaling pathway
    111152507
   04070 Phosphatidylinositol signaling system
    111152507
   04022 cGMP-PKG signaling pathway
    111152507
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111152507
   04210 Apoptosis
    111152507
   04218 Cellular senescence
    111152507
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111152507
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111152507
   04621 NOD-like receptor signaling pathway
    111152507
   04625 C-type lectin receptor signaling pathway
    111152507
  09152 Endocrine system
   04911 Insulin secretion
    111152507
   04922 Glucagon signaling pathway
    111152507
   04929 GnRH secretion
    111152507
   04912 GnRH signaling pathway
    111152507
   04915 Estrogen signaling pathway
    111152507
   04921 Oxytocin signaling pathway
    111152507
   04935 Growth hormone synthesis, secretion and action
    111152507
   04918 Thyroid hormone synthesis
    111152507
   04928 Parathyroid hormone synthesis, secretion and action
    111152507
   04924 Renin secretion
    111152507
   04925 Aldosterone synthesis and secretion
    111152507
   04927 Cortisol synthesis and secretion
    111152507
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111152507
  09154 Digestive system
   04970 Salivary secretion
    111152507
   04971 Gastric acid secretion
    111152507
   04972 Pancreatic secretion
    111152507
  09156 Nervous system
   04724 Glutamatergic synapse
    111152507
   04725 Cholinergic synapse
    111152507
   04728 Dopaminergic synapse
    111152507
   04726 Serotonergic synapse
    111152507
   04720 Long-term potentiation
    111152507
   04730 Long-term depression
    111152507
   04723 Retrograde endocannabinoid signaling
    111152507
  09157 Sensory system
   04742 Taste transduction
    111152507
   04750 Inflammatory mediator regulation of TRP channels
    111152507
  09159 Environmental adaptation
   04713 Circadian entrainment
    111152507
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111152507
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111152507
   05012 Parkinson disease
    111152507
   05014 Amyotrophic lateral sclerosis
    111152507
   05017 Spinocerebellar ataxia
    111152507
   05020 Prion disease
    111152507
   05022 Pathways of neurodegeneration - multiple diseases
    111152507
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111152507
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111152507
   05163 Human cytomegalovirus infection
    111152507
   05167 Kaposi sarcoma-associated herpesvirus infection
    111152507
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111152507
Ion channels [BR:elk04040]
 Ligand-gated channels
  IP3 receptor
   111152507
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 111152507
NCBI-ProteinID: XP_022366691
UniProt: A0A2Y9K0M4
LinkDB
Position
Unknown
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASSYELSDNVGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGEACDPKAAGMGAQSRVGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVELIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMDFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYDDSGGKNVRRSIQGVGHMMSTMVLNRKQSVFGAPSLSAGTGATEPLDRSKFEDNE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRTFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAVHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSSKGEEVD
TGASKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRLADPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSLLSSGTSCIA
AAQRNASNYKATTRAFSRVTPTANQWDYKNIIEKLQDIITALEERLRPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCVKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSSSRGDLPDPVGAGLDQDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPREDREPADPTTKGRVASFSMPGSPSRYSLGPSLRRGHEVGERVQS
NEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRSQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYLEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGP
TLNILGTLNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFVHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPGNHSGASPLGMPHGAATLMGTCSGDKLNCVSGVSVPEVMEGEGELESTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVCNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagcgagatgtccagctttctccacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggttggtggatgaccgctgtgtggtggagcct
gcggcgggggacctggacaacccgcctaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgctactcggctcagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagatcgctgacgtggtgttgctccagaagttgcagcatgcagcccagatggag
cagaagcagaacgacacagagaacaagaaggtgcacggggacgtggtgaagtacggcagc
gtgatccagctcctgcatatgaagagcaacaagtacctgaccgtgaacaagcggctgcca
gcgctgctggagaagaacgccatgcgcgtgacgctggatgcaacaggcaatgaaggctcc
tggctcttcatccagcccttctggaagctgcggagcaatggggacaacgtagtggtgggg
gacaaggtgatcctgaaccctgtcaatgccgggcagcctctgcatgccagcagttacgag
ctcagtgacaacgtgggctgcaaggaggtcaactccgtgaactgcaacaccagctggaag
atcaacctgttcatgcagttccgagaccacctggaggaggtgttgaaagggggagatgtg
gtgcggctgttccatgcagagcaggagaagttcctgacatgcgacgagtacaagggcaag
ctgcaggtgtttctgcgtaccacactgcgccagtctgccacctcggccaccagctccaat
gccctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctggccactgg
aatggcctgtaccgcttcaaacacctggccacgggcaactacctggctgctgaggagaac
cccagctacaagggtgaggcctgtgatcccaaggcagcaggaatgggtgcccagagtcgt
gtaggtcgccggaacgctggagagaagatcaagtaccgcctggtggctgtgccccatggc
aatgacatcgcctccctctttgagctggaccccactacgctgcagaaaactgactccttt
gtgccccggaactcctatgtccggctgcggcatctctgcaccaacacgtggatccagagc
actaacgtgcccatcgatattgaggaggagcggcccattcggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtccgtgcccgtgtctgagatccga
gacctggactttgccaacgatgccagctccatgctggccagtgctgtggagaaactcaat
gagggcttcatcagccaaaatgaccgcaggtttgtcatccagctgctggaggatctggtg
ttcttcgtcagtgacgtccccaacaacgggcagaatgtgctggacatcatggtcaccaag
cccaaccgggaacggcagaagctgatgagagaacagaacatcctcaaacagatctttggc
attctgaaggcccctttccgtgagaaggggggtgagggccccctggtgcgactggaagag
ctgtcggaccagaagaatgccccctaccagcacatgttccgtctctgctaccgggtgctg
cggcattcccaggaggattaccgcaagaaccaggagcacatagccaaacagttcgggatg
atgcaatctcagatcggctacgacatcctggcggaggacaccatcaccgccctgctgcac
aacaatcgtaaactgctggagaagcacatcaccaagactgaggtggagaccttcgtcagc
ctcgtgcgcaagaaccgggagccccggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccccgtcacccaagagctcatctgcaagtgcgttctggaccccaag
aacagcgacattctcatccagaccgagcttcggccagtgaaggagatggctcagtcccac
gagtacctgagcatcgagtattcagaggaggaggtgtggctcacgtggacggacaagaat
aacgagcaccacgagaagagcgtgaggcagctggcgcaggaggcacgggcgggcaatgct
cacgacgagaacgtgcttagctactacaggtaccagctgaagctctttgcccgcatgtgc
ctggaccgccagtacctggccatcgatgagatctcccagcagctgggcgttgagctcatc
ttcctgtgcatggcagacgagatgctgccctttgatctgcgcgcctccttctgccacctg
atgctgcatgtgcacgtggacagggacccccaggagctggtcacgccagtcaagtttgcc
cgcctctggaccgagatccccacagccatcaccatcaaggactatgactccaacctcaac
gcctctcgagacgacaagaagaacaagtttgccagcaccatggacttcgtggaggactac
ctcaacaatgtggtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcacc
ttcgaggtggtcagcctggcgcacaacctcatctacttcggcttctacagcttcagtgag
ctgctgcggctcactcgcacgctgctgggcatcatcgactgcgtgcagggccccccggcc
atgctgcaggcctacgatgactcaggcggcaagaacgtgcgccggtccatccagggcgtg
ggccatatgatgtccaccatggtgctgaaccgcaagcagtctgtctttggggcccccagc
ctgtctgccggcactggtgccactgagccactggacagaagcaagtttgaggacaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatcttgcagttcatcctcaac
gtccgcctagactaccgcatctcctacttgctgtccgtcttcaagaaggagtttgtggaa
gtgtttcccatgcaggacagtggggctgacggcacagctccggccttcgactccacaacc
gccaacatgaacctggaccgcatcggggagcaggcggaggccatgttcggagtggggaag
accagcagcatgctggaggtggacgacgagggcggccgcacgttcctgcgcgtgcttatt
catctcaccatgcacgactatgcgccgctggtctcaggggccctgcagctgctcttcaag
cacttcagccagcgccaggaggccgtgcacaccttcaagcaggtgcagctgctgatctcg
gctcaggatgtggagaactacaaggtgatcaagtcggagctggaccggctgcggaccatg
gtggagaagtcggagctatgggtggacaagaagggcagcagcaagggcgaggaggtggac
acaggtgcttccaaagacaagaaggagcggcccacagacgaggagggctttctgcaccca
cccggggagaagagcagtgagaactaccagatcgtcaagggcatcctggaacggctgaac
aagatgtgtggcgttggcgagcagatgaggaagaagcagcagaggctgctcaagaacatg
gacgcccacaaggtcatgctggatctgctgcagatcccctatgacaagggtgatgccaag
atgatggagatcctgcgctacacccaccagttcctgcagaagttctgcgcggggaacccg
ggcaaccaggccctgctgcataagcacctgcacctcttcctcacaccggggctcctggag
gccgagaccatgcagcatatcttcctgaacaactaccagctgtgctcggagatcagcgag
ccggtgctgcagcacttcgtgcacctgctggccacccacgggcgccacgtgcagtacctg
gacttcctgcacaccgtcatcaaggccgagggcaagtatgtcaagaagtgccaggacatg
atcatgaccgagctgaccaatgcgggtgatgacgtggtggtgttctacaatgacaaggcc
tcgctggcccacctgctggacatgatgaaggctgcccgggatggcgtggaggaccacagc
cccctcatgtaccacatctccctggtggacttgctagctgcctgtgccgagggcaaaaac
gtctacacggagatcaagtgcacctccctgctacccctggaggacgtggtgtctgtggtg
acacatgaggactgtatcactgaggtgaaaatggcatacgtgaactttgtgaatcactgc
tatgtggacacagaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
tttgagaacttcaccctggacatggctcgggtgtgcagtaagcgggagaagcgtctggct
gaccccacgctggaaaagtacgtgctgaccgtcgtgctggacaccatcaacgcgttcttc
agctccccattctctgagaacagcacttccctgcagacacatcagacgatcgtggtgcag
ctgctgcagtccaccacacggctgctcgagtgtccgtggctgcagcagcagcacaagggc
tccgtggaggcctgcatccggaccctcgccatggtggctaaaggccgggccatctcactg
cccatggacctagatgcacatatcagctcgctgctcagcagtgggaccagctgtatagcc
gctgcccagcgcaacgcctccaactacaaggcgaccacacgggccttctcccgtgtcacg
cccactgccaaccagtgggactacaagaacatcatcgagaagctgcaggacattatcaca
gccctggaggagcggctgaggcccctggtacaggccgagctgtcggtgctggtggacgtc
ctgcactggcccgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
gggggtttcctgtccaagctgatccagcacaccaaggacctcatggaatcagaggagaag
ctgtgtgtcaaggtgctgcggaccctgcagcagatgctgctgaagaagaccaagtatggg
gaccggggcaaccagctgcgcaagatgctgctacagaactacctccagaaccggaagtcc
agctcgcggggggaccttccagaccccgtgggcgctggcctggaccaagactggtcagcc
attgcggccacccagtgccggctggacaaggagggggccaccaaactggtatgcgacctg
atcaccagcaccaagaatgagaagatcttccaggagagcatcggcctggccatccgcctg
ctggacggcggcaacactgagatccagaaatccttctacaacctgatgatgagtgacaag
aagtcagaacgcttcttcaaagtgttgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacagtggctgtcaacatgaacgacctgggcagccagccacgggaggaccgggag
ccagcagaccccaccaccaaaggccgcgtagcttccttctcgatgccgggctccccgtcc
cgatattcgctgggccccagcctgcgccggggccacgaggtgggcgagcgcgtacagagc
aacgagatgggcacatccgtgctcatcatgcagcccatcctgcgcttcctgcagctgctg
tgtgagaatcacaaccgggacctgcagaacttcctgcgctctcagaacaacaagaccaac
tacaacctggtgtgcgagacgctccagtttctggacatcatgtgcggcagcaccacaggt
ggcctggggctgctgggcctttacatcaatgaggacaatgtgggccttgtcatccagacc
ctggagaccctcactgagtactgccagggcccctgccacgagaaccagacttgcatcgtg
acgcacgagtccaatggcatcgacatcatcacagccctgattctcaatgacatcagtccc
ctgtgcaagtaccgtatggacctggtgctgcagcttaaggacaatgcgtccaagctgctc
ttggctctgatggagagccggcacgacagtgaaaacgcggagcgaatcctcatcagcctg
cggccccaagagctggtggacgtcatcaagaaagcctacctgcaggaggaggagcgggag
aactcagaggtgagcccacgggaagtgggccacaacatctacatcctggcgctgcagctc
tccaggcacaacaagcagctgcagcacctgctgaagccggtgaagcgcatccaggaggaa
gaggccgagggcatctcttccatgctcagcctcaacaacaagcagctgtcccagatgctc
aagtcctcagcgcccgcccaggaggaggaggaggaccccctggcctactacgagaaccac
acgtcccagatagagatcgtgaggcaggaccgcagcatggagcagatcgtgttccccgtg
cctggcatctgccaattcctgacggaggagaccaagcatcggctcttcaccaccaccgag
caggatgagcagggcagcaaagtgagcgatttcttcgaccagtcctccttcctgcacaac
gaaatggaatggcagcgcaagctccgcagcatgccactgatctactggttctcccgccgc
atgaccctgtggggcagcatttccttcaacctggcggtgtttatcaacatcatcatcgcc
ttcttctacccctacctggagggcgcatccacaggcgtgctgggctccccactcatctcc
ctgctgttctggatcctcatctgtttctccatcgcggctctgttcaccaagcgctacagc
gtccgccccctcattgtggcgctcatcctgcgctccatctactacctgggcattgggccc
acactcaacatcctgggcaccctcaatctgaccaacaagattgtctttgtggtgagcttc
gtgggcaaccgcggtaccttcatccggggctataaggccatggtcatggacatggagttc
ctctaccatgtgggctacatcctgactagtgtcctgggcctctttgtccacgagctcttc
tacagtatcctgctctttgacctcatctaccgcgaggagacgctgttcaacgtcatcaag
agcgtgactcgcaatggccgctccatcctgctgaccgccctactggccctcatcctcgtc
tacctcttctccatcgttggcttcctcttcctcaaggacgacttcatcctcgaggtcgac
cggctgccgggcaatcactctggagccagccccctggggatgccacatggagctgccaca
ctcatgggcacatgcagtggggacaagctgaactgtgtctcgggggtctcagtgcctgag
gtcatggaaggtgagggcgagctggagagcacggagcgggcttgtgacactttgctgatg
tgcatcgtcactgtcatgaatcacgggctgcgcaatggtggcggcgtgggcgacattctc
cgaaagccctccaaagacgagtctctcttcccagcccgggtggtctacgacctcctgttc
ttcttcatcgtcatcatcatcgtgctgaacctcatcttcggagtgatcatcgacaccttc
gctgatctgcgcagcgagaagcagaagaaggaagagattctcaagaccacgtgcttcatc
tgtgggctggagagagacaagtttgataacaagacggtgtcctttgaggagcacatcaag
ttcgaacacaacatgtggaactacctgtacttcatcgtgctagtccgtgtgaaaaacaag
acagactacacggggcccgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgagggccatgtccctagtgtgcaacgagggggaaggggagcagaat
gagatccggattcttcaggacaagctcaactccaccatgaagctcgtgtcccacctcacc
gcccagctcaacgagctcaaggagcaaatgacagagcagcggaaacgcaggcaacgcctg
ggcttcgtggacgtccagaactgcatgagccgctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159979
Entry
111159979         CDS       T05871                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2 isoform X1
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04114  Oocyte meiosis
elk04210  Apoptosis
elk04218  Cellular senescence
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111159979
   04020 Calcium signaling pathway
    111159979
   04070 Phosphatidylinositol signaling system
    111159979
   04022 cGMP-PKG signaling pathway
    111159979
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111159979
   04210 Apoptosis
    111159979
   04218 Cellular senescence
    111159979
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111159979
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111159979
   04621 NOD-like receptor signaling pathway
    111159979
   04625 C-type lectin receptor signaling pathway
    111159979
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111159979
   04929 GnRH secretion
    111159979
   04912 GnRH signaling pathway
    111159979
   04915 Estrogen signaling pathway
    111159979
   04921 Oxytocin signaling pathway
    111159979
   04935 Growth hormone synthesis, secretion and action
    111159979
   04918 Thyroid hormone synthesis
    111159979
   04928 Parathyroid hormone synthesis, secretion and action
    111159979
   04924 Renin secretion
    111159979
   04925 Aldosterone synthesis and secretion
    111159979
   04927 Cortisol synthesis and secretion
    111159979
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111159979
  09154 Digestive system
   04970 Salivary secretion
    111159979
   04971 Gastric acid secretion
    111159979
   04972 Pancreatic secretion
    111159979
  09156 Nervous system
   04724 Glutamatergic synapse
    111159979
   04725 Cholinergic synapse
    111159979
   04728 Dopaminergic synapse
    111159979
   04726 Serotonergic synapse
    111159979
   04720 Long-term potentiation
    111159979
   04730 Long-term depression
    111159979
   04723 Retrograde endocannabinoid signaling
    111159979
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111159979
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111159979
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111159979
   05012 Parkinson disease
    111159979
   05017 Spinocerebellar ataxia
    111159979
   05020 Prion disease
    111159979
   05022 Pathways of neurodegeneration - multiple diseases
    111159979
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111159979
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159979
   05163 Human cytomegalovirus infection
    111159979
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159979
Ion channels [BR:elk04040]
 Ligand-gated channels
  IP3 receptor
   111159979
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p DUF1798
Other DBs
NCBI-GeneID: 111159979
NCBI-ProteinID: XP_022378413
UniProt: A0A2Y9KZA0
LinkDB
Position
Unknown
AA seq 2701 aa
MSDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLTNPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNRGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNMRDGDLPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVLNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKLVSMQVDNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQVPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVQPSIHPSKQGSPIE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENNENTETSASGSPDTVLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYENGE
MGESQVKGGEEPIEDSSILSPVQDGTRKPQIDSNKSNNYWIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLKIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCVPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKSSVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFLKSHSNMVQRAAMGWRLSARSGPRFKEALGGPSWDYRNIIEKLQDVVASLEQQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYGVGPNGHLSGTYCKSAQGAGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSSLLLK
EGMKGQLTEASSATSKAYCAYRREMDPEIDIMCAGSEAGNTEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVVLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGEDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDDGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGILSPLFSVLLWIAVAVCTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSNEVPTMTLTSTMETCEKDSCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
GEQNEIRNLQEKLESTMSLVKQLSAQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPS
H
NT seq 8106 nt   +upstreamnt  +downstreamnt
atgtctgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccctggggttagtggatgacagatgtgtggtgcac
cctgaagcgggagacctcaccaaccctcccaagaaattcagagactgcctctttaaggtg
tgccctatgaaccgatattctgcccagaaacaatactggaaagctaagcaagccaaacag
gggaaccacacagaggcagccttgctgaagaaattacagcatgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaaactgttgggagaaattgtgaaatacagtaatgtt
atacaactgctgcatataaaaagcaacaagtatctgactgtcaacaagaggttacctgct
ttactggagaagaacgccatgcgtgtgtccttggatgctgcaggaaatgaagggtcttgg
ttttatattcatcccttctggaagctgagaagtgagggtgacaatattgtcgtgggtgat
aaagttgttctgatgcccgtgaacgcgggacagccgctgcacgccagcaacatagagctt
ctcgataatcgagggtgcaaggaggtgaatgctgttaattgcaacactagctggaaaatc
actttattcatgaaatatagttcctatcgagaggatgtactaaaaggaggtgatgttgtt
agactgtttcatgcagaacaagagaagtttctgacttgtgatgaatatgagaagaaacag
cacattttccttcggacaaccttgcgtcaatcagccacttctgctaccagttctaaagcg
ctctgggaaatagaggtcgttcaccatgacccatgccgcgggggtgctggacaatggaac
agcttgttcagatttaaacaccttgcaactgggaactatttagctgcagagcttaatcct
gattatcgagatgctcaaaatgaaggaaaaaatatgagagatggagatcttccaacttca
aagaagaaacgccaggccggggagaagatcatgtatactttagtctcagtcccacatgga
aatgacattgcatccctgtttgagctggatgccacaactcttcagagagctgactgcctg
gttccaaggaactcttatgttcggttgagacatttatgtaccaacacatgggtaacaagt
actagtatacccatagacacagatgaagagagacctgttatgttgaagattggaacttgc
caaacgaaagaagataaagaagcatttgccattgtgtctgtcccattgtctgaggtccga
gacttagactttgccaatgatgcaaataaagtgctggcaaccacagttaaaaagctggaa
aatggtacaataactcagaatgaaaggaggtttgtaaccaaattattggaagacctcatc
ttctttgtggctgatgtacttaataatggacaagaagttctggatgtggttatcactaag
ccaaaccgagaacgtcaaaaattgatgagggaacaaaacatattggcacaggtatttggg
attctcaaagcaccctttaaagagaaggcaggagaaggctcaatgctgagacttgaagat
ctgggggaccaaagatacgctccctacaagtatatgctgaggctgtgttaccgtgtgctg
agacattcacaacaggactatcggaaaaaccaggaatatattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagataccatcacagctttgttgcac
aacaacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagt
ttactcaggagaaatcgtgagccaaggtttttggattatttgtcagatctatgtgtttct
aataccactgctatacctgtaactcaagaactcatctgtaaatttatgctgagcccaggc
aatgcagacattctcattcaaactaagctggtttcaatgcaagtagacaaccccatggag
agctccatcctctcggatgacattgatgatgaagaagtttggctctactggattgacagc
aacaaggaacctcatggcaaagctatcaggcaccttgctcaagaagcaaaagaaggcacc
aaagctgatttggaagttcttacctattataggtaccagctaaacctctttgcaaggatg
tgcttggatcgccagtatctggccataaaccagatttctacgcagctctctgtggatttg
atcctgcggtgtgtgtcggatgagagcctgccctttgacctccgagcgtctttttgtcgc
ctcatgcttcacatgcatgttgaccgggatccccaggaatccgtggtgcctgttcgctac
gcccggctctggaccgaaattcctacaaagatcacaattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgcactgacaatggaatttgttgaagaa
tacttgaaagaagttgtaaatcagccctttccttttggggataaagaaaaaaacaaactg
acatttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagc
gaattgttaagactaacaagaacacttctggctatcctagatattgtacaggtccccatg
tcatcgtattttgaaagactaagcaaatttcaagatggtggaaacaatgtcatgagaacc
atccatggggtgggagagatgatgacccaaatggtactcagtcgaggctccatcttcccc
atgagtgtgcctgacgttcagcccagcatccaccccagcaagcaggggagccccatagag
catgaagatgtgaccgtgatggacaccaaactcaagattattgagattctgcagtttatc
ctgagtgtcagactagattataggatctcatatatgctgtcaatatacaagaaggaattt
ggagagaacaatgagaacacggaaacgtctgccagtggctctccagatacagtactacca
tcagctattgttcctgatatagatgaaattgcagcccaggcagaaactatgtttgctgga
agaaaggagaaaaatccagttcaacttgatgatgaaggaggcaggacctttctacgtgtc
ctcattcatctgatcatgcatgactaccctcctttgctctcaggagccctacagctactg
ttcaagcacttcagccagagagcagaagtcttacaggcgtttaaacaggtgcaattgctg
gtgtccaatcaagatgtagataactacaagcaaatcaaggcagatctagaccagcttcga
ctaacggtggaaaaatctgagttatgggttgagaagagcagcagctatgagaatggagaa
atgggtgaaagtcaagtaaaaggtggtgaagaacccattgaggactcaagcattttaagt
ccagtgcaggatggaacaaggaaacctcagattgacagcaataagagcaataactactgg
attgtgaaggagattttgattagactaagtaaactctgtgtccagaataaaaagtgtcgg
aatcagcatcaacgattactgaaaaatatgggagctcattcggtggtgttggatcttctg
aagataccctatgaaaagaatgatgaaaagatgaacgaagtgatgaatctggcccacacc
ttcctgcagaatttctgccggggaaatccacagaaccaagttctccttcataaacatctg
aatttgtttttaactcctggtctcctggaagcagaaaccatgcggcacatcttcatgaac
aattaccatctctgcaatgagatcagcgagagagttgtgcaacactttgtgcattgcatc
gagacacacggccgccatgtggagtacctgaggtttctgcaaacgattgtaaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaa
gatgtgctgatattttacaatgatagagcatcatttcccatccttctccatatgatgtgt
tcagagagagaccgaggggatgagagtggccccttagcctaccacatcaccctggtggag
ctgctggcagcatgcacagaggggaagaacgtctacactgaaatcaagtgcaattccctt
ctgcccttggacgacatagtgagggttgtgacccatgatgactgcgtccccgaggttaaa
attgcttatgtgaattttgttaatcactgttatgtggacactgaagtggaaatgaaagaa
atctacacgagtaaccacatttggaaattatttgagaacttcttggtggacatggcaagg
gtttgcaatacaaccacggacaggaaacacgcagacaccttcctggagaagtgtgtcact
gagtcaataatgaacattgtgagcggcttctttaattcccccttttcagacaacagtacc
agcctccagacacatcagccagtttttattcagctgctgcaatctgccttcagaatttac
aattgtacctggccaaacccagcgcagaagtcctccgtggagtcttgtatcagaactctg
gcagaagtggcaaagaatcgtgggattgctattccggtggatttggacagccaagtcaat
acccttttcctgaagagccattccaatatggtgcagagagctgccatgggttggagacta
tctgctcgctctggaccacgctttaaggaagctcttggagggccttcttgggattataga
aatattattgaaaagttacaggatgtagtggcctcgttggagcaacagttcagcccaatg
atgcaagctgaattctctgtgttggttgatgtgttgtacagtccggaactactgtttccc
gaggggagtgatgcaagaataagatgtggtgccttcatgtccaagttgattaatcataca
aagaaactaatggagaaagaagaaaagctgtgcattaaaattcttcagactttacgagaa
atgctagagaagaaagacagctttgtggaagagggtaacacattaagaaaaatactcctg
aatcgctactttaaaggagactatggagttggtccgaatggacacctctctgggacctac
tgcaaatctgcacaaggggcagggagcttttctggacaagattcagataagatggggata
tcaatgtcagatattcagtgtctgctggataaagaaggtgcatctgaacttgtcattgat
gttatagtgaacaccaaaaatgacaggattttttcagaaggcattttacttggcattgcc
ttgctcgaaggaggaaatacacagactcagtattccttctaccagcagttgcacgaacaa
aaaaagtcagaaaaattcttcaaagttctctatgaccgaatgaaggctgctcagaaagag
ataagatcaacagtgacagttaataccatagacttaggtaacaaaaaaagggatgatgac
aatgaattgatgacatctggtccacgaatgagagtaagagattcatcattacttttgaaa
gagggaatgaaagggcaattaacagaagcttcttcagcgacatccaaagcatactgtgcc
taccgaagggaaatggatccagaaatagacattatgtgtgcaggatcggaagcgggaaac
actgaggaaaagtctgcggaggaagtcacgatgagccctgcgatcgccatcatgcagccc
atactgcggtttcttcagctgctgtgtgagaatcacaaccgggaactgcagaacttcttg
aggaatcaaaacaacaaaacaaattataacctcgtctgtgaaacccttcagtttttggac
tgcatctgtggaagtaccacgggtggcctgggcctgttgggtctctacatcaatgagaag
aatgtagtactggtcaaccagactctggagagcttgacggaatattgccagggcccatgc
catgaaaatcagacttgtattgctactcatgaatcaaatgggattgatatcatcattgct
ttgattctaaatgacataaaccctctgggtaaatatcgaatggatctggtgctccaacta
aagaacaatgcctctaagcttttgctggccattatggaaagcagacatgacagtgagaac
gcggaaagaattctttttaacatgagacccagggaactggtggatgtgatgaagaatgcc
tataaccaaggactggaatgtgaccatggggaggatgagggcggagatgatggtgtttcc
ccaaaagatgttggacacaatatctatatcctggcccatcagttggctcgtcacaacaaa
ctcttacagcaaatgctcaaaccaggatcagatccagatgacggggatgaagctttaaaa
tattacgccaaccacactgcacagattgagattgttcggcatgataggacgatggagcaa
atagtttttcctgtccccaatatatgtgaataccttacacgagaatccaagtgccgtgtg
ttcaatacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaaca
gaagatctctacaatgaaatgaagtggcagaagaaaatcaggaataaccctgcactgttc
tggttctcgaggcacatatccctctgggggagcatttccttcaacttggctgtgttcatc
aatttagctgttgctctcttctatccatttggggatgacggagatgaaggtatactttct
ccgttgttctccgttcttctttggatagccgtcgctgtctgcacatctatgctgtttttc
ttctccaagcctgtgggtattcggccatttcttgtgtcaataatgctcaggtcgatatat
acaataggtcttgggcctacgttaatacttcttggtgcagctaatctttgtaataaaatc
gtatttctggtgagttttgtgggcaatcgtggcaccttcacccgaggctaccgagcagta
atcctggatatggcctttctctaccacgtggcgtacgttctggtttgcatgctgggtctc
tttgtccatgaattcttctatagcttcctgctttttgatttggtgtacagagaagagact
ctgcttaatgtcataaagagtgtcacgcggaatggccgctccatcattctaactgccgtc
ctggcgctcatcctcgtctacctgttttccattattgggttccttttcctgaaggatgac
ttcacgatggaggtggaccggctgaaaaacagaactcctgtgacaggtagtaatgaagtt
cctactatgactttaacttcaacgatggaaacatgtgaaaaggacagctgctcacccaca
ataccggcttcaaatacagctgatgaagagtatgaggatggaattgaaaggacatgtgac
actctcctcatgtgtatcgtcactgtcctgaaccagggccttcggaatggcggtggtgtg
ggagacgttctcaggaggccatcgaaagatgagcctttgtttgctgcccgagtggtgtat
gaccttcttttctatttcattgtcatcattattgtcctaaacttgatttttggtgttatc
attgatacttttgctgatctcagaagtgaaaaacagaaaaaagaagagattctaaagaca
acctgcttcatctgtggacttgagagagacaagtttgataataaaacggtttcatttgag
gagcacatcaagtcagaacacaatatgtggcattatttgtacttcctcgtcctggtgaag
gttaaagacccaactgaatacactggacctgaaagttacgtggctcagatgatcgtggag
aagaatttagactggtttcctcggatgcgagccatgtccctcgttagcaatgaaggtgat
ggtgagcaaaatgagattcggaacctgcaggagaagttggaatccaccatgagcttggtc
aaacagctgtcggcacagctggcagagctcaaagagcagatgacagaacaaaggaagaat
aagcagagactgggctttctcggatcaaacacaccccatgtgaaccatcacatgccatca
cactga

DBGET integrated database retrieval system