KEGG   Enhydra lutris kenyoni (northern sea otter): 111144026
Entry
111144026         CDS       T05871                                 

Definition
(RefSeq) transforming protein RhoA isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04144  Endocytosis
elk04150  mTOR signaling pathway
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04350  TGF-beta signaling pathway
elk04360  Axon guidance
elk04510  Focal adhesion
elk04520  Adherens junction
elk04530  Tight junction
elk04611  Platelet activation
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04660  T cell receptor signaling pathway
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04810  Regulation of actin cytoskeleton
elk04921  Oxytocin signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04972  Pancreatic secretion
elk05100  Bacterial invasion of epithelial cells
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111144026
   04015 Rap1 signaling pathway
    111144026
   04310 Wnt signaling pathway
    111144026
   04350 TGF-beta signaling pathway
    111144026
   04072 Phospholipase D signaling pathway
    111144026
   04071 Sphingolipid signaling pathway
    111144026
   04024 cAMP signaling pathway
    111144026
   04022 cGMP-PKG signaling pathway
    111144026
   04150 mTOR signaling pathway
    111144026
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111144026
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111144026
   04520 Adherens junction
    111144026
   04530 Tight junction
    111144026
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111144026
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111144026
   04621 NOD-like receptor signaling pathway
    111144026
   04625 C-type lectin receptor signaling pathway
    111144026
   04660 T cell receptor signaling pathway
    111144026
   04670 Leukocyte transendothelial migration
    111144026
   04062 Chemokine signaling pathway
    111144026
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111144026
   04928 Parathyroid hormone synthesis, secretion and action
    111144026
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111144026
  09154 Digestive system
   04972 Pancreatic secretion
    111144026
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111144026
  09158 Development and regeneration
   04360 Axon guidance
    111144026
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144026
   05206 MicroRNAs in cancer
    111144026
   05205 Proteoglycans in cancer
    111144026
   05203 Viral carcinogenesis
    111144026
  09162 Cancer: specific types
   05210 Colorectal cancer
    111144026
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111144026
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111144026
   05135 Yersinia infection
    111144026
   05133 Pertussis
    111144026
   05152 Tuberculosis
    111144026
   05100 Bacterial invasion of epithelial cells
    111144026
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111144026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111144026
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111144026
   04031 GTP-binding proteins [BR:elk04031]
    111144026
Membrane trafficking [BR:elk04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    111144026
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111144026
  Exosomal proteins of other body fluids (saliva and urine)
   111144026
  Exosomal proteins of colorectal cancer cells
   111144026
  Exosomal proteins of bladder cancer cells
   111144026
GTP-binding proteins [BR:elk04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    111144026
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 111144026
NCBI-ProteinID: XP_022353801
UniProt: A0A2Y9IZL7
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt
ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatatcgaagttgatggaaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgaccgcttgaggcctctctcctatccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaatatcccagaaaaatggacc
ccggaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system