KEGG   Enhydra lutris kenyoni (northern sea otter): 111144142
Entry
111144142         CDS       T05871                                 

Definition
(RefSeq) cytokine-inducible SH2-containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
elk04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111144142
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111144142
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111144142
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:elk04990]
    111144142
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111144142
Domain-containing proteins not elsewhere classified [BR:elk04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   111144142
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 111144142
NCBI-ProteinID: XP_022354008
UniProt: A0A2Y9IZF2
LinkDB
Position
Unknown
AA seq 257 aa
MVLCVQGPCSLLAVERIGQRPLWAQSLELPEPAMQPLPAGSFLEEVAEETPAQPESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADPRSDSPDPAP
TPALPTPKEDVPGDPALPVPTVTAVHLKLVQPFVLRSSARSLQHLCRLVINRLVADVDCL
PLPRRMADYLRQYPFQL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcaggggccttgttctttgctggctgtggagcggatcgggcagcgg
cccctgtgggcccagtccctggagctgcccgaaccagctatgcagcctttgcctgccggg
tcctttctggaggaagtggcagaggagaccccagcccagccggagagtgagcccaaggtg
ctggacccagaggaggacctgctgtgcatagccaagaccttctcttacctccgggaatct
ggctggtactggggttccattacggccagcgaggcccggcaacacctgcagaagatgcca
gaaggcacattcctcgtccgcgacagcacccaccccagctacctcttcaccctgtcggtc
aaaaccacccgaggccccaccaatgtgcgcatcgagtacgccgactccagcttccgcctg
gactccaactgcctgtccaggccacgcatcctggccttccccgacgtggtcagcctggtg
cagcactatgtggcctcctgtgccgccgacccccggagcgacagccctgaccctgcgccc
accccggccctgcctaccccgaaggaggatgtgcccggcgacccggcgctgcccgtgccc
acagtcacggccgtgcacctgaagctggtacagccatttgtgctccgaagcagcgcccgc
agcctgcagcacctgtgccgcctcgtcatcaaccgcctggtggctgacgtggactgcctg
ccgctgccccggcgcatggccgactacctccggcagtaccccttccagctctga

DBGET integrated database retrieval system