KEGG   Enhydra lutris kenyoni (northern sea otter): 111144147
Entry
111144147         CDS       T05871                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04015  Rap1 signaling pathway
elk04072  Phospholipase D signaling pathway
elk04080  Neuroactive ligand-receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04810  Regulation of actin cytoskeleton
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111144147
   04072 Phospholipase D signaling pathway
    111144147
   04151 PI3K-Akt signaling pathway
    111144147
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111144147
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111144147
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144147
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:elk04030]
    111144147
G protein-coupled receptors [BR:elk04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111144147
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 zf-UBR 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 111144147
NCBI-ProteinID: XP_022354019
UniProt: A0A2Y9J2T4
LinkDB
Position
Unknown
AA seq 351 aa
MATMGRCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFVRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVLLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDA
EMRRTFRRLLCCLCLRRSPHESARYAPSTRTGASTRIMLPENGHPLMDSTL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccaccatgggccggtgctactacaatgagaccatcggctttttctacaacaacagt
ggcaaggagctcagctcccactggcggcccaaagatgtggttgtggtggccctggggctg
actgtcagcgtgctggtgctcctgactaacttgctggtgatcgcagctatcgcctccaat
cgccgcttccaccagcccatttactacctgctcggcaacctggccgcagctgacctcttt
gcaggcgtggcctacctcttcctcatgtttcacacgggccctcgcaccgccaggctctcg
ctggagggctggttcgtgcggcagggcctgctggacacaagcctaactgcctcggtggcc
acactgctagccatcgccgtggagcggcaccgcagcgtgatggccgtgcagctgcacagc
cgcctgccccgcggccgtgttgtcctgctcatcgtgggggtgtgggtggccgcgctgggc
ctggggctgctgcccgcccactcatggcactgcctctgcgccctggaccgctgctcacgc
atggcccctctgctcagccgctcctacctggctgtctgggcactgtccagcctgcttgtc
ttcctgctcatggtggctgtctatacccgcattttcttctacgtgaggcggagggtgcag
cgtatggcagagcacgtcagctgccacccccgctaccgagagaccacactcagcctagtc
aagaccgttgtcattatcctgggagcattcgtggtctgctggacaccaggccaggtggtg
ctgctcctggatggtctaggctgcaagtcctgcaacgttctggccgtggagaagtatttc
ctactcttggcagaggccaactcactggtcaacgctgtggtgtactcatgccgagacgct
gagatgcgtcgcaccttccgccgcctcctctgctgtctgtgccttcgccggtcgccccac
gagtctgcccgctatgctccctctacccgaacaggggccagcacgcgcatcatgcttcca
gagaacggccaccccctgatggactccaccctgtag

DBGET integrated database retrieval system