KEGG   Enhydra lutris kenyoni (northern sea otter): 111144227
Entry
111144227         CDS       T05871                                 

Definition
(RefSeq) C-C chemokine receptor type 3
  KO
K04178  C-C chemokine receptor type 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04062  Chemokine signaling pathway
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111144227
   04061 Viral protein interaction with cytokine and cytokine receptor
    111144227
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111144227
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111144227
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111144227
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144227
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:elk04030]
    111144227
   04050 Cytokine receptors [BR:elk04050]
    111144227
   04090 CD molecules [BR:elk04090]
    111144227
G protein-coupled receptors [BR:elk04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    111144227
Cytokine receptors [BR:elk04050]
 Chemokine receptors
  CC Chemokine
   111144227
CD molecules [BR:elk04090]
 Proteins
  111144227
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 111144227
NCBI-ProteinID: XP_022354147
UniProt: A0A2Y9IZT8
LinkDB
Position
Unknown
AA seq 360 aa
METLTAVMKSMDASVETTVFDYEDSVPCEKVNIRELGAQFLPPLYSLVFVVGLLGNVVVV
VILTKYKRLRIMTNIFLLNLAISDLLFLVSLVFWIHYVMWNKWVFGPFMCKLLSGLYYMG
LYSEIFFIILLTVDRYLAIVHAVFALRARTATFSVIMSVLTWGLAGLATVPEFIFYESQK
EASQHVCMPLYPKNQEDRWKRFHALRMNILGLALPLLIMVVCYSGIIKTLLRCPGKKKYK
AIRLIFVIMVVFFIFWTPYNLALLLSAFQTVFFETNCEQSKQLDVAMQVTEVIAYTHCCV
NPIIYAFVGERFRKHLCHFFRRHVVTYLGKYIPFLPSEKSDRASFSVSPSTGEQEFSFVF
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggagaccctcacggccgtgatgaagagcatggatgcgtctgttgagaccacagtgttc
gactatgaggattcagtgccatgtgaaaaagtcaacatcagggagctgggagcccagttc
ttgcccccgctgtactccctggtgttcgtggttggtctgctgggcaatgtggtggtggtg
gtcatcctcacaaaatataagaggctcaggattatgaccaacatcttcctgctcaatttg
gccatttctgacttgctctttctagtctctctggtattctggattcactatgttatgtgg
aacaagtgggtttttggtcccttcatgtgtaaactcctctctgggctttattacatgggc
ttatatagtgagatctttttcatcatcctgctgaccgtagaccggtacctggccatcgtc
cacgccgtgtttgccctacgagcccggactgccactttcagtgtcatcatgagtgttcta
acctggggcctggcagggctagcaaccgtccctgaatttatcttctatgagtcccaaaag
gaggcctcccaacatgtctgcatgcctctttacccaaaaaaccaagaagatagatggaag
cgtttccatgccctgagaatgaatatcttgggtcttgctctgcctctgctcatcatggtt
gtctgctactctggaattattaaaacactgctgagatgccccggcaagaaaaagtacaag
gccatccggctcatttttgtcatcatggtggtctttttcattttctggacaccctacaac
ctggccctcctcctctctgcttttcaaacagtcttctttgagacaaactgtgagcagagc
aaacagctggacgtggccatgcaggtgacagaggtgatcgcctacacgcactgctgcgtc
aaccccatcatctatgccttcgtcggagagcggttccggaagcatctctgccacttcttc
cgcaggcacgtggtcacctacctgggaaaatacatcccgttccttcccagcgagaagtca
gacagagccagcttctctgtatccccatcaacaggggagcaggaattctcatttgtattt
taa

DBGET integrated database retrieval system