KEGG   Enhydra lutris kenyoni (northern sea otter): 111144267
Entry
111144267         CDS       T05871                                 

Definition
(RefSeq) protein shisa-5 isoform X1
  KO
K10135  scotin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111144267
SSDB
Motif
Pfam: Shisa
Other DBs
NCBI-GeneID: 111144267
NCBI-ProteinID: XP_022354200
UniProt: A0A2Y9J8J4
LinkDB
Position
Unknown
AA seq 240 aa
MAARIPALRILLLLLLLLPPPPGAHSEVCVASHGHNFFPESCPDFCCGNCYNQYCCSDEL
KKFVGNEDSCAEPKASVSAGTEPLEQLGSALRFRSSLDSDPMSGFGATVAIGLTIFVLTV
VTVIICFTCSCCSLYKMCRRPPRPVVTTTTATTVVHTPYPQPPSVPPSYPGPTYQGYHPM
PPQPGMPAAPYPTQYPPPYPAQPMGPPAYHETLAGGAAMPYPASQPPYNPAYMDPPKAVP
NT seq 723 nt   +upstreamnt  +downstreamnt
atggctgcgcggatccccgcgctccggatcctactgctgctgcttctgctgctcccgccg
cctccaggtgcccacagtgaggtgtgtgtggcttcccatggacacaacttcttcccagag
tcctgtcctgatttctgctgcggcaactgttacaaccaatactgctgctccgacgagctg
aagaaatttgtggggaacgaggatagctgcgcagagcccaaggccagtgtgtctgccggt
accgagcccctggagcagctgggctcggcgctgaggttccgttccagcttggacagcgac
cccatgtcagggtttggggcaacggtagccatcggcctgaccatcttcgtgctcactgtt
gtcaccgtcatcatctgcttcacctgttcctgctgctctctctataagatgtgccgccgg
cccccgcgtccggtggtcaccaccaccacggccacaacggtggtgcacaccccttaccct
cagcctccgagtgtgccccccagctacccaggaccgacgtaccagggctaccaccccatg
cccccacagccagggatgccagcagcaccttacccgacacagtaccccccgccttaccct
gcccagcctatgggccccccagcataccacgagacactggctggaggtgcggccatgccc
taccctgccagccagcctccttacaacccggcctacatggacccaccgaaggcagttccc
tga

DBGET integrated database retrieval system