KEGG   Enhydra lutris kenyoni (northern sea otter): 111144489
Entry
111144489         CDS       T05871                                 

Definition
(RefSeq) tissue-type plasminogen activator
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04371  Apelin signaling pathway
elk04610  Complement and coagulation cascades
elk05202  Transcriptional misregulation in cancer
elk05215  Prostate cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111144489
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111144489
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111144489
  09162 Cancer: specific types
   05215 Prostate cancer
    111144489
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111144489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111144489
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111144489
Enzymes [BR:elk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     111144489
Peptidases and inhibitors [BR:elk01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111144489
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   111144489
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 Trypsin_2 hEGF
Other DBs
NCBI-GeneID: 111144489
NCBI-ProteinID: XP_022354499
UniProt: A0A2Y9J452
LinkDB
Position
Unknown
AA seq 560 aa
MKRELVCVLLLFGAALSLSSQEIHTRFRRGARSYRVSCRDEKTQTLYLQNESWLRPGLRG
NRVEYCRCVGGRPQCHSVPVRSCSEPRCFNGGVCRQALYFSDFVCQCPEGFMGKRCEIDA
SVTCYKDQGITYRGTWSTAESGAECVNWNSSALALKPYTGRRPNAVQLGLGNHNYCRNPD
RDSRPWCYVFKAGKYSSEFCSTPACPKEKNEDCYFGKGLAYRGTYSLTASGTSCLYWNSA
ALAGKVYTAWKSNSQALGLGNHNYCRNPDGDAKPWCHVLKDRKLTWEYCDVPQCSTCGLR
QYKQPQFRIKGGLYTDITSHPWQAAIFVKNRRSPGERFFCGGILISSCWVLSAAHCFQER
YNPHHLRVVLGRTYREVPGEEEQKFEVEKYVIHEEFEDDTYNNDIVLLKLQSDSLHCAQE
SDAVRAVCLPEATLQLPDWTECELSGYGKHEASSPFYSERLKEAHVRLYPSSRCTSQHLF
NKTITKNMLCAGDTRSGGNQANLHDACQGDSGGPLVCMKDNRMTLVGIISWGIGCGQKDV
PGIYTKVTNYLDWIQNNMRP
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgaagagagagctggtgtgcgttctgctgctttttggagcagccctctccttgtccagc
caggaaatccacacccgattcagaagaggagccagatcttacagagtgagctgcagagat
gagaagacgcagacactctacctgcagaacgagtcatggctgcgcccgggcctgcggggc
aaccgcgtggagtactgtcgctgcgtgggtggccgcccacagtgccactctgtgcccgtc
cgaagttgcagcgaacccaggtgcttcaatggcggggtatgccggcaggctctctacttc
tcagattttgtctgccagtgtcctgaagggtttatggggaagcgctgcgaaatagatgcc
agtgtcacctgctacaaggaccagggtatcacctataggggcacatggagcacagcggaa
agcggggccgagtgtgtcaactggaacagcagcgcgctggccttgaagccgtacactggg
aggaggcccaacgccgtccagctgggccttggcaatcacaattactgcagaaaccccgac
cgtgactcgaggccctggtgctacgtcttcaaggcagggaagtacagcagtgagttctgc
agcacgccagcctgccccaaggaaaaaaatgaggactgctactttggaaaggggttagca
taccgtggcacatacagcctcactgcgtctggtacctcctgcctctactggaattctgca
gccctagcaggcaaggtctacacagcatggaagagcaattctcaggcgctgggcctgggc
aaccacaattactgccggaacccagatggggatgccaagccttggtgtcacgtgctgaag
gaccgcaagttgacgtgggaatactgcgacgtcccccagtgctccacctgtggtctgaga
cagtacaagcagccgcagttccgcatcaaaggagggctctacacagacatcacctctcat
ccatggcaggccgccatctttgtcaagaacaggaggtcaccaggagagaggtttttttgt
ggcggaatactgatcagttcctgctgggtcctatctgctgcccactgcttccaggagagg
tacaatccccaccacctcagggtggttttgggcaggacataccgcgaggtccccggagaa
gaggagcagaaatttgaggttgagaaatacgtcatccatgaggaatttgaggatgacact
tacaacaatgacattgtcctgctaaaactgcagtcggactcgctacactgcgcccaggag
agcgacgctgtccgtgccgtgtgtctgcccgaggccaccctgcagctgcccgactggaca
gagtgcgagctgtctggctacggcaagcacgaggcgtcttctcctttctattctgagcgg
ctgaaggaggctcatgtcaggctgtacccatctagccgctgcacttcacagcatctgttt
aacaaaaccatcaccaaaaacatgctgtgcgctggagacacgcggagcggtgggaaccag
gcaaacctgcacgatgcctgccagggggactcaggcggccccttggtgtgtatgaaggat
aaccgcatgactttggttggcatcatcagttggggcatcggctgcgggcagaaagacgtt
cctggcatatataccaaggttactaattacctagactggattcaaaacaatatgcgaccg
tga

DBGET integrated database retrieval system