KEGG   Enhydra lutris kenyoni (northern sea otter): 111144538
Entry
111144538         CDS       T05871                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk03013  RNA transport
elk04012  ErbB signaling pathway
elk04066  HIF-1 signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04218  Cellular senescence
elk04910  Insulin signaling pathway
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05168  Herpes simplex virus 1 infection
elk05221  Acute myeloid leukemia
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111144538
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111144538
   04066 HIF-1 signaling pathway
    111144538
   04151 PI3K-Akt signaling pathway
    111144538
   04152 AMPK signaling pathway
    111144538
   04150 mTOR signaling pathway
    111144538
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111144538
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111144538
  09149 Aging
   04211 Longevity regulating pathway
    111144538
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    111144538
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111144538
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111144538
   05163 Human cytomegalovirus infection
    111144538
   05165 Human papillomavirus infection
    111144538
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111144538
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111144538
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     111144538
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 111144538
NCBI-ProteinID: XP_022354568
UniProt: A0A2Y9J0W1
LinkDB
Position
Unknown
AA seq 118 aa
MSGGSGCSQTPSRAIPATRRVILGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPASEEPPTEPSQNHLRTSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtctgggggcagcggctgcagccagaccccaagtcgggccatcccggccactcgccgg
gtgatcctcggcgacggcgtgcagctgccgcccggggactacagcaccacccccggcggc
acgctcttcagcaccaccccgggaggtaccaggatcatctacgaccggaagttcctgatg
gagtgtcggaactcccctgtgaccaaaacacctccaagggacctgcccaccattcccggg
gtcaccagccctgccagtgaggagccccccacagagcccagccagaaccacctgcgcacc
agcccggaagataagccagccggcggtgaagagtcacagtttgaaatggacatttaa

DBGET integrated database retrieval system