KEGG   Enhydra lutris kenyoni (northern sea otter): 111144592
Entry
111144592         CDS       T05871                                 

Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta isoform X1
  KO
K11220  signal transducer and activator of transcription 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04062  Chemokine signaling pathway
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05140  Leishmaniasis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05212  Pancreatic cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111144592
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111144592
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111144592
   04621 NOD-like receptor signaling pathway
    111144592
   04625 C-type lectin receptor signaling pathway
    111144592
   04658 Th1 and Th2 cell differentiation
    111144592
   04659 Th17 cell differentiation
    111144592
   04062 Chemokine signaling pathway
    111144592
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111144592
   04935 Growth hormone synthesis, secretion and action
    111144592
   04919 Thyroid hormone signaling pathway
    111144592
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111144592
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144592
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111144592
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111144592
  09163 Immune disease
   05321 Inflammatory bowel disease
    111144592
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111144592
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111144592
  09172 Infectious disease: viral
   05161 Hepatitis B
    111144592
   05160 Hepatitis C
    111144592
   05171 Coronavirus disease - COVID-19
    111144592
   05164 Influenza A
    111144592
   05162 Measles
    111144592
   05168 Herpes simplex virus 1 infection
    111144592
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144592
   05169 Epstein-Barr virus infection
    111144592
   05165 Human papillomavirus infection
    111144592
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111144592
   05140 Leishmaniasis
    111144592
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111144592
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111144592
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 BLI1
Other DBs
NCBI-GeneID: 111144592
NCBI-ProteinID: XP_022354714
UniProt: A0A2Y9J595
LinkDB
Position
Unknown
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERRILENAQ
RFNQAQSGSIQNTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQLLIQKMYLMLDNKRKEVVLKIIELLNVTELTQKALINDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPIVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERPQNGGEPHFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtcgcagtggtacgagctgcagcagcttgactccaaattcctggagcaggttcaccag
ctctacgatgacagttttcccatggaaatcagacagtacctggcacagtggctagaaaaa
caagactgggagcatgctgctaatgacgtttcatttgccaccatccgttttcatgacctc
ctatcccagctggatgatcagtatagtcgcttttctttggagaataattttttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaagaagacccaatacag
atgtctatgatcatctgtaactgtctgaaggaagaaaggaggatcctggaaaatgctcag
agattcaatcaggcacagtcggggagtatccagaacaccgtgatgttagacaaacagaag
gagcttgacagcaaagtcagaaatgtgaaggataaggttatgtgtatagagcatgaaata
aagaccctagaagatttacaagacgaatatgacttcaagtgcaaaaccttgcagaacaga
gagcatgaaaccaatggtgtggcaaagaatgatcagaaacaagaacagttgttaatccag
aagatgtatttaatgcttgacaataagagaaaggaagtagttctcaaaataatagagttg
ttgaatgttacggaacttacccagaaagccctgatcaatgatgagctggtggaatggaag
cagagacagcagagcgcctgcatcggggggccccccaacgcttgtcttgatcagctgcag
aactggttcaccatagttgcggagagtctgcagcaggtgcgtcagcagctgaaaaagctc
gaggagttggaacagaaatacacctacgaacacgaccctatcacaaaaaacaagcaaggc
ctgtgggaccgcaccttcagccttttccagcagctcattcagagctcatttgtggtggaa
agacaaccttgcatgccaactcatcctcagaggccgctggtcttgaagaccggggtccag
ttcaccgtgaagttgagactgctggtgaaattgcaagagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttaggaagttc
aacattttgggcacgcacacaaaagtgatgaacatggaagagtccacgaacgggagtctg
gcggcggagttccggcacctgcaactgaaggaacagaaaaatgctggcaccagaactaac
gagggccctctcatcgttactgaagagcttcactccctcagttttgagacccagctgtgc
cagcctggtttggtcattgacctcgagacgacctctctgcccatcgtggtgatctccaac
gtcagccagctgccgagtggttgggcctccatcctgtggtacaacatgctggtgacagaa
ccccggaatctgtccttcttcctgaacccaccttgtgcacgatggtctcagctctcggag
gtgctcagctggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctcaac
atgctgggagagaaactactcggtcctaatgctggccctgatggtctcattccatggaca
aggttctgtaaggaaaacataaatgataaaaattttcccttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctctctctctggaatgatgggtgtatcgtgggc
ttcatcagcaaggagcgggagcgcgcgctgctgaaggaccagcagcccgggacgttcctg
ctgcgcttcagcgagagctgccgcgaaggcgccatcacgttcacgtgggtggagcgcccc
cagaacggaggagaacctcacttccatgccgttgagccctacacgaagaaagaactttct
gctgttactttccctgatattattcgcaattacaaagttatggctgctgaaaatattcca
gagaatcccctgaagtatctgtatccgaatattgataaagaccatgcctttgggaaatac
tactccaggccaaaggaagccccagaaccaatggaactcgatggccctaaaggaactgga
tacatcaagacagagttgatttctgtgtctgaagttcacccctctcgacttcagaccaca
gacaacctgctccccatgtctcccgaggagtttgacgaggtgtcacggatagtgggttct
gtcgagttcgacagtatgatgaatgcagtatag

DBGET integrated database retrieval system