KEGG   Enhydra lutris kenyoni (northern sea otter): 111144797
Entry
111144797         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04720  Long-term potentiation
elk04724  Glutamatergic synapse
elk04728  Dopaminergic synapse
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111144797
   04310 Wnt signaling pathway
    111144797
   04370 VEGF signaling pathway
    111144797
   04020 Calcium signaling pathway
    111144797
   04022 cGMP-PKG signaling pathway
    111144797
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111144797
   04218 Cellular senescence
    111144797
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111144797
   04650 Natural killer cell mediated cytotoxicity
    111144797
   04660 T cell receptor signaling pathway
    111144797
   04658 Th1 and Th2 cell differentiation
    111144797
   04659 Th17 cell differentiation
    111144797
   04662 B cell receptor signaling pathway
    111144797
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111144797
   04921 Oxytocin signaling pathway
    111144797
   04924 Renin secretion
    111144797
  09156 Nervous system
   04724 Glutamatergic synapse
    111144797
   04728 Dopaminergic synapse
    111144797
   04720 Long-term potentiation
    111144797
  09158 Development and regeneration
   04360 Axon guidance
    111144797
   04380 Osteoclast differentiation
    111144797
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111144797
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111144797
   05014 Amyotrophic lateral sclerosis
    111144797
   05020 Prion disease
    111144797
   05022 Pathways of neurodegeneration - multiple diseases
    111144797
  09165 Substance dependence
   05031 Amphetamine addiction
    111144797
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111144797
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111144797
   05170 Human immunodeficiency virus 1 infection
    111144797
   05163 Human cytomegalovirus infection
    111144797
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144797
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111144797
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111144797
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     111144797
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 111144797
NCBI-ProteinID: XP_022354977
UniProt: A0A2Y9J295
LinkDB
Position
Unknown
AA seq 534 aa
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDERLIYGNKKVGSAAARKEIIRNKIR
AIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGF
SPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtaccctttcccccaacacatcgcttgacatct
gaagaagtatttgatatggatgggatacccagggttgatgttctgaagaaccacttagta
aaagaaggtcgggtagatgaagaaattgcacttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaggctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggtcctgaagattctgtacccaagcacattatttcttctgcgaggcaatcat
gaatgcaggcaccttactgaatattttacctttaagcaggaatgcaaaattaaatattca
gaaagagtctatgaagcttgtatggaagcttttgatagcctgcctcttgctgcactttta
aatcaacaatttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgcta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcccaattttatggatgtcttcaca
tggtcgttaccatttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactgatgactgaaggtgaagaccagtttgatgaacggctcatatat
ggcaataaaaaagtaggttcagctgcagcccggaaagaaatcataagaaacaaaattcga
gcaattggcaagatggcaagggtcttctctgttctcagggaggagagtgaaagtgtgctg
acactcaagggcctgactcccacagggatgttgcctagtggagtgttggctggaggacga
cagaccctgcaaagtgccacagttgaggctattgaggctgaaaaagcaatacgaggattc
tctccaccacatagaatctgcagttttgaagaggcaaagggtttggataggatcaatgag
agaatgccaccccggaaagatgctgtacagcaagatggtttcaattccctgaacaccgca
catgccactgagaaccacgggactggcaaccatagtgcccagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111146053
Entry
111146053         CDS       T05871                                 

Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04720  Long-term potentiation
elk04724  Glutamatergic synapse
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111146053
   04310 Wnt signaling pathway
    111146053
   04370 VEGF signaling pathway
    111146053
   04020 Calcium signaling pathway
    111146053
   04022 cGMP-PKG signaling pathway
    111146053
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111146053
   04218 Cellular senescence
    111146053
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111146053
   04650 Natural killer cell mediated cytotoxicity
    111146053
   04660 T cell receptor signaling pathway
    111146053
   04658 Th1 and Th2 cell differentiation
    111146053
   04659 Th17 cell differentiation
    111146053
   04662 B cell receptor signaling pathway
    111146053
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111146053
   04921 Oxytocin signaling pathway
    111146053
   04924 Renin secretion
    111146053
  09156 Nervous system
   04724 Glutamatergic synapse
    111146053
   04720 Long-term potentiation
    111146053
  09158 Development and regeneration
   04360 Axon guidance
    111146053
   04380 Osteoclast differentiation
    111146053
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111146053
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111146053
   05014 Amyotrophic lateral sclerosis
    111146053
   05020 Prion disease
    111146053
   05022 Pathways of neurodegeneration - multiple diseases
    111146053
  09165 Substance dependence
   05031 Amphetamine addiction
    111146053
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111146053
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111146053
   05170 Human immunodeficiency virus 1 infection
    111146053
   05163 Human cytomegalovirus infection
    111146053
   05167 Kaposi sarcoma-associated herpesvirus infection
    111146053
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111146053
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     111146053
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 111146053
NCBI-ProteinID: XP_022357138
UniProt: A0A2Y9J840
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPEEICSHFNSDEIKRLSKKFKKLDLDRSGSLSLEEFLSLPELHQNPLVQRVID
VFDTDGNGEVDFKEFILGASQFSVRGDEEEKLRFAFSIYDIDKDGYISNGELFQVLKLMV
GDNLKDWQLQQLVDKTIIVLDRDGDGKISFEEFSAVVRGLDVHKKLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagccagttacccggaggagatatgctcccacttcaactccgatgaaatt
aaaagactgagcaagaagtttaagaagctggacttggaccgttcaggctctctgagcttg
gaggagttcttgtccctgcccgagctgcaccagaacccgttggtgcagcgagtgatcgac
gtcttcgacaccgatggcaatggagaagtggacttcaaggagttcatcctgggggcctcc
cagttcagcgtcaggggggacgaggaggagaagttgaggtttgccttcagcatctatgac
attgataaagacggctacatttccaacggggagctcttccaggtgctgaagctgatggtg
ggcgacaacctgaaggactggcagttacagcagctagtggacaaaaccatcatcgtcctg
gatcgggatggagacgggaaaatatcttttgaggagttcagcgctgtggtcagaggcctg
gatgtccacaagaagttggtggtgattgtgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111148007
Entry
111148007         CDS       T05871                                 

Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04720  Long-term potentiation
elk04724  Glutamatergic synapse
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111148007
   04310 Wnt signaling pathway
    111148007
   04370 VEGF signaling pathway
    111148007
   04020 Calcium signaling pathway
    111148007
   04022 cGMP-PKG signaling pathway
    111148007
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111148007
   04218 Cellular senescence
    111148007
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111148007
   04650 Natural killer cell mediated cytotoxicity
    111148007
   04660 T cell receptor signaling pathway
    111148007
   04658 Th1 and Th2 cell differentiation
    111148007
   04659 Th17 cell differentiation
    111148007
   04662 B cell receptor signaling pathway
    111148007
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111148007
   04921 Oxytocin signaling pathway
    111148007
   04924 Renin secretion
    111148007
  09156 Nervous system
   04724 Glutamatergic synapse
    111148007
   04720 Long-term potentiation
    111148007
  09158 Development and regeneration
   04360 Axon guidance
    111148007
   04380 Osteoclast differentiation
    111148007
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111148007
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111148007
   05014 Amyotrophic lateral sclerosis
    111148007
   05020 Prion disease
    111148007
   05022 Pathways of neurodegeneration - multiple diseases
    111148007
  09165 Substance dependence
   05031 Amphetamine addiction
    111148007
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111148007
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111148007
   05170 Human immunodeficiency virus 1 infection
    111148007
   05163 Human cytomegalovirus infection
    111148007
   05167 Kaposi sarcoma-associated herpesvirus infection
    111148007
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111148007
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     111148007
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 111148007
NCBI-ProteinID: XP_022360050
UniProt: A0A2Y9JQG7
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagttatcctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctagggaagagatttaagaagcttgatttggacaattcgggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atatttgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgccgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154144
Entry
111154144         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04720  Long-term potentiation
elk04724  Glutamatergic synapse
elk04728  Dopaminergic synapse
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111154144
   04310 Wnt signaling pathway
    111154144
   04370 VEGF signaling pathway
    111154144
   04020 Calcium signaling pathway
    111154144
   04022 cGMP-PKG signaling pathway
    111154144
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111154144
   04218 Cellular senescence
    111154144
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111154144
   04650 Natural killer cell mediated cytotoxicity
    111154144
   04660 T cell receptor signaling pathway
    111154144
   04658 Th1 and Th2 cell differentiation
    111154144
   04659 Th17 cell differentiation
    111154144
   04662 B cell receptor signaling pathway
    111154144
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111154144
   04921 Oxytocin signaling pathway
    111154144
   04924 Renin secretion
    111154144
  09156 Nervous system
   04724 Glutamatergic synapse
    111154144
   04728 Dopaminergic synapse
    111154144
   04720 Long-term potentiation
    111154144
  09158 Development and regeneration
   04360 Axon guidance
    111154144
   04380 Osteoclast differentiation
    111154144
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111154144
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111154144
   05014 Amyotrophic lateral sclerosis
    111154144
   05020 Prion disease
    111154144
   05022 Pathways of neurodegeneration - multiple diseases
    111154144
  09165 Substance dependence
   05031 Amphetamine addiction
    111154144
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111154144
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154144
   05170 Human immunodeficiency virus 1 infection
    111154144
   05163 Human cytomegalovirus infection
    111154144
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111154144
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111154144
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     111154144
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 111154144
NCBI-ProteinID: XP_022369270
UniProt: A0A2Y9KIY0
LinkDB
Position
Unknown
AA seq 525 aa
MSGRNHHLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDILKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTVFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIKKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEIEGGTTVRKEVIKNKIRAIGKMARVFSILREESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPPR
KDSQYPDGPVKLVGPAQSNAAHRSDRGRRANSDTEPCCGTGGSKT
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccgggaggaaccaccacctctccaccaccgaacgcgtcatcaaagctgttcccttt
cctccaacccaacggcttactttgaaggaagtatttgagaatgggaaacctaaaattgat
attttgaaaaaccatttggtgaaggaagggcgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgagacaagagaagaccatgatagaagtagaggctcca
atcacggtgtgtggtgacattcatggacaattctttgacctgatgaagttgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgattatgtggacagaggctat
ttcagtatagagtgtgtgctgtttttatggagtttaaaaattaatcatcccaaaacagtg
tttctacttcgaggaaatcatgaatgcaggcatcttacagagtatttcaccttcaaacag
gaatgtcgaatcaaatattccgaacaggtgtatgatgcttgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctgtgtgtacatggagggatgtcacct
gaaattactagtttagatgacattaagaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgatctgctttggtctgatccttcagaggattatggcaatgagaagacc
ttggagcactatactcacaacactgtccgagggtgctcttatttttacagctaccctgca
gtttgtgaatttttgcagaacaataatttgttatcaataatcagagcccacgaagcccag
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccgtcactcattaca
attttctctgcccccaattacctagatgtctataataataaagctgctgtgctaaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctattggcttcca
aactttatggatgttttcacatggtctttgccatttgttggggaaaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttctgatgatgaaattgaa
ggaggcactacagttcggaaggaggtcatcaagaataaaatcagagccattgggaagatg
gcacgggtcttctcaattctgcgagaagagagtgagagcgtgctgactcttaagggcttg
actccaacaggaacactccctctaggtgtcctctcaggaggaaaacagactattgagacg
gccacagtagaagcggtagaggcccgggaagccatcagagggttttcacttcagcacagg
atccggagttttgaagaagcccgaggtctggaccgaattaatgagcggatgccaccccga
aaagacagccagtaccccgatgggccagtgaaattggtgggccctgcacagtccaatgct
gcgcacaggagtgacagggggagaagagccaatagtgacacagagccctgctgtggcaca
ggtggatccaaaacttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154566
Entry
111154566         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04114  Oocyte meiosis
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04720  Long-term potentiation
elk04724  Glutamatergic synapse
elk04728  Dopaminergic synapse
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04924  Renin secretion
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05152  Tuberculosis
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111154566
   04310 Wnt signaling pathway
    111154566
   04370 VEGF signaling pathway
    111154566
   04020 Calcium signaling pathway
    111154566
   04022 cGMP-PKG signaling pathway
    111154566
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111154566
   04218 Cellular senescence
    111154566
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111154566
   04650 Natural killer cell mediated cytotoxicity
    111154566
   04660 T cell receptor signaling pathway
    111154566
   04658 Th1 and Th2 cell differentiation
    111154566
   04659 Th17 cell differentiation
    111154566
   04662 B cell receptor signaling pathway
    111154566
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111154566
   04921 Oxytocin signaling pathway
    111154566
   04924 Renin secretion
    111154566
  09156 Nervous system
   04724 Glutamatergic synapse
    111154566
   04728 Dopaminergic synapse
    111154566
   04720 Long-term potentiation
    111154566
  09158 Development and regeneration
   04360 Axon guidance
    111154566
   04380 Osteoclast differentiation
    111154566
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111154566
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111154566
   05014 Amyotrophic lateral sclerosis
    111154566
   05020 Prion disease
    111154566
   05022 Pathways of neurodegeneration - multiple diseases
    111154566
  09165 Substance dependence
   05031 Amphetamine addiction
    111154566
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111154566
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154566
   05170 Human immunodeficiency virus 1 infection
    111154566
   05163 Human cytomegalovirus infection
    111154566
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111154566
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111154566
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     111154566
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 111154566
NCBI-ProteinID: XP_022369926
UniProt: A0A2Y9K915
LinkDB
Position
Unknown
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatgggaaa
ccccgtgtggatatcttaaaggcacatctcatgaaggagggcaggctggaagagagcgtt
gcattgagaataataacagagggggcttcaattctccgacaggaaaaaaatttgctggat
attgatgcaccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctttttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttat
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagaatatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtctatgacgcctgtatggat
gcctttgactgcctgcccctggctgccctgatgaaccagcagttcctgtgtgtccacggt
ggtttgtctcccgagattaacaccttagacgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagaccccctggaggattttgga
aatgagaagactcaggaacatttcactcacaacacagtccgggggtgttcgtacttctac
agttacccggctgtatgtgaattcttacagcacaataatttgttatctatactccgagcc
catgaagcccaagatgcagggtatcgcatgtacaggaaaagccaaacgacaggcttccct
tctctaattacaattttctcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaacgtcatgaatatcaggcaattcaactgttctcctcaccca
tactggcttccaaatttcatggatgttttcacttggtccctaccatttgttggggaaaaa
gtgaccgagatgctggtaaatgtgctcaacatctgctcagatgatgaactggggtcagaa
gaagatggatttgatggagcaacagccgcggcccggaaggaggtgataagaaacaagatc
cgagcaataggcaaaatggcccgagtgttctcggttctcagagaagagagcgagagcgtg
ctgacgctgaaaggcttgacccccacgggcatgctccccagcggagtgctttctggaggg
aagcagacactgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaat
gagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

DBGET integrated database retrieval system