KEGG   Enhydra lutris kenyoni (northern sea otter): 111144809
Entry
111144809         CDS       T05871                                 

Definition
(RefSeq) signal transducing adapter molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111144809
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111144809
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111144809
Membrane trafficking [BR:elk04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    111144809
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT
Other DBs
NCBI-GeneID: 111144809
NCBI-ProteinID: XP_022355006
UniProt: A0A2Y9J3D0
LinkDB
Position
Unknown
AA seq 497 aa
MDICDKVGSTPNGAKDCLKAIMKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDF
ATEVRAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQ
TASAATRNGASSNKSREDEEIAKAIELSLQEQKQQHAETKSLYPSAEIQLNNKVARKVRA
LYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSNFVTTNLNIESEAAAV
DKLNVIDDEEEEIKKSEPEPVYIDEDKMDRALQVLQSIDPTDSKPDSQDLLDLEDICQQM
GPMIDEKLEEIDRKHSELSELNVKVLEALELYNKLVNEAPVYPLYSKLHPPAHYPPSSAG
VPMQTYPVQSHGGNYMGQGIHQVTVPQSYSIGPDPIGPLRSVPPNVNSSVTTQPAQIPYL
STGQDTVSNPAYMNQNSNLQSAAGTAAYTQQMGMSVDMSSYQNATSSSLPQLAGFPVAVP
AHSVAQQQTNYHQQPLL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggacatatgtgacaaagttggaagcactcctaatggagcaaaagattgcttaaaggcc
ataatgaagagagtaaatcataaggttcctcatgttgctctgcaggcattaactcttctt
ggggcttgtgtggcaaactgtggaaagatatttcatttagaagtatgttcccgtgatttt
gcaacagaagtacgtgctgtgataaaaaataaggctcatcctaaggtatgtgaaaaactg
aagtctttgatggtagagtggtcagaagaatttcagaaggatcctcagtttagtctaata
tctgcaactattaaatctatgaaagaagaaggaattacttttcctccagcaggttctcag
actgcctcagctgccacccggaatggtgcatcatcgaacaaaagcagagaagatgaagaa
atagcaaaagctattgaattatcattgcaagagcagaagcagcagcatgcagaaacaaaa
tccttatatccctctgcagaaattcagttaaataataaagttgcaaggaaagtgagagct
ttatatgattttgaagccgttgaggacaatgaactcacctttaaacatggtgaaattatt
attgttttggatgacagtgatgccaattggtggaaaggagaaaatcacagaggaatagga
ctcttcccatctaattttgtaacaactaatttaaacatagagtctgaggcagcagctgtg
gacaaattgaatgtaattgatgatgaggaggaggaaattaagaaatcagagcctgagcct
gtttatatagatgaggataagatggatagagccctgcaggtactccagagtatagatcca
acagattcaaaaccagactcccaagacctcttggatttagaagatatctgccaacagatg
ggtccaatgatagatgaaaaacttgaggagattgataggaagcattcagaattgtctgaa
ttgaatgtaaaagtcttggaagccctggaactatataacaagttggtgaatgaagcaccg
gtatatccactctattcaaagctccatcctccggcacattaccccccttcatcagccggg
gttccaatgcagacatacccagttcagtcacatggtggaaactatatgggtcaaggcatt
caccaagtcactgttccccaaagctatagcataggaccagatcccattggtccactgaga
tctgtgcctccaaatgtcaattcctcggtgacaacacagcctgcacagattccatattta
agcactggacaagacactgtttccaaccctgcttacatgaaccagaactctaaccttcag
tcagctgctggtactgctgcttacacacagcagatggggatgtctgtggatatgtcatct
taccagaacgctacttcttccagtttgccacaactggccggctttccagtggcagttcca
gctcattcagtcgcacagcagcaaacaaattaccatcagcagcctcttctttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155550
Entry
111155550         CDS       T05871                                 

Definition
(RefSeq) signal transducing adapter molecule 1
  KO
K04705  signal transducing adaptor molecule
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04144  Endocytosis
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111155550
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111155550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111155550
Membrane trafficking [BR:elk04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    111155550
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 111155550
NCBI-ProteinID: XP_022371473
UniProt: A0A2Y9KE88
LinkDB
Position
Unknown
AA seq 541 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSVMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGMGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEQA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAICHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYMQSSGVSGSQVYPGPPQSGTYLVAGSA
QMSHLQSYSLPPEQLSSLSQGAVPPSVNPALPSQQTQASYPNTMVSSVQGNTYPNQASVY
SPPAAAAAAAAAAADVTIYQNAGTNMSQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKAL
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgcctctttttgccaccaatcccttcgatcaagatgttgagaaagcaaccagtgagatg
aatactgctgaggattggggcctcattttggatatttgtgataaagtcggtcaatctcga
actggacccaaagattgtcttcggtctgttatgaggagggtgaaccataaagatcctcat
gttgctatgcaagctctgactcttctaggagcatgtgtatcaaactgtggcaaaatattt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtactaaacaagggt
caccctaaagtctgtgaaaagttaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaagaaccttaaggaacaaggagtt
acgtttccagctattggctctcaggctgcagaacaagcaaaagcaagcccagccttggtt
gccaaagatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagctatt
gagttgtctttgaaggaacaaaggcagcagtcaaccaccctttctactttatacccaagc
acatccaatctcttaactaaccaccaacatgaaggccgaaaagttcgtgccatatatgac
tttgaagctgctgaagataatgaacttacttttaaagctggagaaataattacagttctt
gatgacagtgatcccaactggtggaaaggtgaaacccatcaaggcatggggctatttccc
tctaattttgtaactgctgatcttactgctgaaccagaaatgattaaaacggagaagaag
acggtacaatttagtgatgatgttcaagtggaaacaatagagccagaaccagagcaagcc
tttattgatgaagacaaaatggaccaattgctacagatgttgcaaagtacagatcccagt
gatgatcaaccagatcttccagagttacttcatcttgaagcaatttgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aatgttaaagtgatggaagcactttcactgtatacgaagttaatgaatgaagatccaatg
tactccatgtatgcgaaattacagaatcagcagtattacatgcagtcatctggtgtttct
ggttctcaggtatatccagggcctccccaaagtggtacttacctggttgcagggagtgca
cagatgagccatctccagagctacagtcttcccccagagcaactgtcttctctcagccaa
ggagcagttccaccatctgtaaacccagcccttcccagtcagcagactcaggcgtcctac
cctaacacaatggtcagttctgttcaaggaaatacatatcccaaccaggcttcagtatat
agtcctcctgctgctgctgctgctgctgctgctgctgctgctgatgtcactatataccag
aatgcaggaactaatatgtcccaggtgccgaactataatttaacatcatcaacactgcct
cagccaggaggcagtcaacagccacctcagccacagcaaccatattctcagaaggctctg
ctatag

DBGET integrated database retrieval system