KEGG   Enhydra lutris kenyoni (northern sea otter): 111144860
Entry
111144860         CDS       T05871                                 

Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04024  cAMP signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04137  Mitophagy - animal
elk04140  Autophagy - animal
elk04141  Protein processing in endoplasmic reticulum
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04310  Wnt signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04530  Tight junction
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04917  Prolactin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04926  Relaxin signaling pathway
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05231  Choline metabolism in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111144860
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111144860
   04012 ErbB signaling pathway
    111144860
   04014 Ras signaling pathway
    111144860
   04310 Wnt signaling pathway
    111144860
   04668 TNF signaling pathway
    111144860
   04068 FoxO signaling pathway
    111144860
   04071 Sphingolipid signaling pathway
    111144860
   04024 cAMP signaling pathway
    111144860
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111144860
   04137 Mitophagy - animal
    111144860
  09143 Cell growth and death
   04210 Apoptosis
    111144860
   04215 Apoptosis - multiple species
    111144860
   04217 Necroptosis
    111144860
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111144860
   04530 Tight junction
    111144860
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111144860
   04621 NOD-like receptor signaling pathway
    111144860
   04622 RIG-I-like receptor signaling pathway
    111144860
   04625 C-type lectin receptor signaling pathway
    111144860
   04660 T cell receptor signaling pathway
    111144860
   04658 Th1 and Th2 cell differentiation
    111144860
   04659 Th17 cell differentiation
    111144860
   04657 IL-17 signaling pathway
    111144860
   04664 Fc epsilon RI signaling pathway
    111144860
  09152 Endocrine system
   04910 Insulin signaling pathway
    111144860
   04920 Adipocytokine signaling pathway
    111144860
   04912 GnRH signaling pathway
    111144860
   04914 Progesterone-mediated oocyte maturation
    111144860
   04917 Prolactin signaling pathway
    111144860
   04926 Relaxin signaling pathway
    111144860
   04935 Growth hormone synthesis, secretion and action
    111144860
  09156 Nervous system
   04728 Dopaminergic synapse
    111144860
   04723 Retrograde endocannabinoid signaling
    111144860
   04722 Neurotrophin signaling pathway
    111144860
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111144860
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111144860
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144860
   05231 Choline metabolism in cancer
    111144860
  09162 Cancer: specific types
   05210 Colorectal cancer
    111144860
   05212 Pancreatic cancer
    111144860
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111144860
   05012 Parkinson disease
    111144860
   05016 Huntington disease
    111144860
   05017 Spinocerebellar ataxia
    111144860
   05020 Prion disease
    111144860
   05022 Pathways of neurodegeneration - multiple diseases
    111144860
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111144860
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111144860
   04932 Non-alcoholic fatty liver disease
    111144860
   04931 Insulin resistance
    111144860
   04933 AGE-RAGE signaling pathway in diabetic complications
    111144860
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111144860
   05135 Yersinia infection
    111144860
   05133 Pertussis
    111144860
   05152 Tuberculosis
    111144860
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111144860
   05170 Human immunodeficiency virus 1 infection
    111144860
   05161 Hepatitis B
    111144860
   05171 Coronavirus disease - COVID-19
    111144860
   05162 Measles
    111144860
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144860
   05169 Epstein-Barr virus infection
    111144860
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111144860
   05142 Chagas disease
    111144860
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111144860
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111144860
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111144860
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 111144860
NCBI-ProteinID: XP_022355117
UniProt: A0A2Y9J2D9
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattt
acagtcttgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgctatcaagaagctaagccggcca
tttcagaaccagactcatgctaaacgggcttacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgagagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatcgtggtaaaa
tcagactgcactttgaagattcttgattttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgccctgaattcatgaagaaactacagccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtgcttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaaggatttctgtagatgaagctctccagcacccatat
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacatacaatagaagaatggaaagagttgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttataaggggacagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcagatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154016
Entry
111154016         CDS       T05871                                 

Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04024  cAMP signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04137  Mitophagy - animal
elk04140  Autophagy - animal
elk04141  Protein processing in endoplasmic reticulum
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04310  Wnt signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04530  Tight junction
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04917  Prolactin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04926  Relaxin signaling pathway
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05231  Choline metabolism in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111154016
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111154016
   04012 ErbB signaling pathway
    111154016
   04014 Ras signaling pathway
    111154016
   04310 Wnt signaling pathway
    111154016
   04668 TNF signaling pathway
    111154016
   04068 FoxO signaling pathway
    111154016
   04071 Sphingolipid signaling pathway
    111154016
   04024 cAMP signaling pathway
    111154016
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111154016
   04137 Mitophagy - animal
    111154016
  09143 Cell growth and death
   04210 Apoptosis
    111154016
   04215 Apoptosis - multiple species
    111154016
   04217 Necroptosis
    111154016
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111154016
   04530 Tight junction
    111154016
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111154016
   04621 NOD-like receptor signaling pathway
    111154016
   04622 RIG-I-like receptor signaling pathway
    111154016
   04625 C-type lectin receptor signaling pathway
    111154016
   04660 T cell receptor signaling pathway
    111154016
   04658 Th1 and Th2 cell differentiation
    111154016
   04659 Th17 cell differentiation
    111154016
   04657 IL-17 signaling pathway
    111154016
   04664 Fc epsilon RI signaling pathway
    111154016
  09152 Endocrine system
   04910 Insulin signaling pathway
    111154016
   04920 Adipocytokine signaling pathway
    111154016
   04912 GnRH signaling pathway
    111154016
   04914 Progesterone-mediated oocyte maturation
    111154016
   04917 Prolactin signaling pathway
    111154016
   04926 Relaxin signaling pathway
    111154016
   04935 Growth hormone synthesis, secretion and action
    111154016
  09156 Nervous system
   04728 Dopaminergic synapse
    111154016
   04723 Retrograde endocannabinoid signaling
    111154016
   04722 Neurotrophin signaling pathway
    111154016
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111154016
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111154016
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154016
   05231 Choline metabolism in cancer
    111154016
  09162 Cancer: specific types
   05210 Colorectal cancer
    111154016
   05212 Pancreatic cancer
    111154016
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111154016
   05012 Parkinson disease
    111154016
   05016 Huntington disease
    111154016
   05017 Spinocerebellar ataxia
    111154016
   05020 Prion disease
    111154016
   05022 Pathways of neurodegeneration - multiple diseases
    111154016
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111154016
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111154016
   04932 Non-alcoholic fatty liver disease
    111154016
   04931 Insulin resistance
    111154016
   04933 AGE-RAGE signaling pathway in diabetic complications
    111154016
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111154016
   05135 Yersinia infection
    111154016
   05133 Pertussis
    111154016
   05152 Tuberculosis
    111154016
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154016
   05170 Human immunodeficiency virus 1 infection
    111154016
   05161 Hepatitis B
    111154016
   05171 Coronavirus disease - COVID-19
    111154016
   05162 Measles
    111154016
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154016
   05169 Epstein-Barr virus infection
    111154016
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111154016
   05142 Chagas disease
    111154016
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111154016
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111154016
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111154016
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 111154016
NCBI-ProteinID: XP_022369074
UniProt: A0A2Y9KBX3
LinkDB
Position
Unknown
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatttgaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aagaacattattagtttattaaatgtcttcacaccccagaaaacattggaggagttccaa
gatgtttacttagtcatggaactaatggatgccaacctgtgtcaggtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctcgactttggactggccaggacagcaggcacgagcttcatgatg
actccgtatgtggtcacacgttattatagagcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcaactagga
acaccatgtccagaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttactgtcaaagatgcta
gtgatcgacccagcaaaaagaatatcggtggatgacgccttacagcatccttacatcaac
gtttggtatgaccctgccgaagtggaggcgcctccacctcagatttatgacaaacaactg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaagaagtaatgaat
tcagaagaaaagactaaaaacggtgttgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcttcgtccgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgatactgacagcagcctggaagcttcagcaggacccctg
ggttgttgcaggtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158897
Entry
111158897         CDS       T05871                                 

Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04024  cAMP signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04137  Mitophagy - animal
elk04140  Autophagy - animal
elk04141  Protein processing in endoplasmic reticulum
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04310  Wnt signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04530  Tight junction
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04723  Retrograde endocannabinoid signaling
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04917  Prolactin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04926  Relaxin signaling pathway
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05231  Choline metabolism in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111158897
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111158897
   04012 ErbB signaling pathway
    111158897
   04014 Ras signaling pathway
    111158897
   04310 Wnt signaling pathway
    111158897
   04668 TNF signaling pathway
    111158897
   04068 FoxO signaling pathway
    111158897
   04071 Sphingolipid signaling pathway
    111158897
   04024 cAMP signaling pathway
    111158897
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111158897
   04137 Mitophagy - animal
    111158897
  09143 Cell growth and death
   04210 Apoptosis
    111158897
   04215 Apoptosis - multiple species
    111158897
   04217 Necroptosis
    111158897
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111158897
   04530 Tight junction
    111158897
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111158897
   04621 NOD-like receptor signaling pathway
    111158897
   04622 RIG-I-like receptor signaling pathway
    111158897
   04625 C-type lectin receptor signaling pathway
    111158897
   04660 T cell receptor signaling pathway
    111158897
   04658 Th1 and Th2 cell differentiation
    111158897
   04659 Th17 cell differentiation
    111158897
   04657 IL-17 signaling pathway
    111158897
   04664 Fc epsilon RI signaling pathway
    111158897
  09152 Endocrine system
   04910 Insulin signaling pathway
    111158897
   04920 Adipocytokine signaling pathway
    111158897
   04912 GnRH signaling pathway
    111158897
   04914 Progesterone-mediated oocyte maturation
    111158897
   04917 Prolactin signaling pathway
    111158897
   04926 Relaxin signaling pathway
    111158897
   04935 Growth hormone synthesis, secretion and action
    111158897
  09156 Nervous system
   04728 Dopaminergic synapse
    111158897
   04723 Retrograde endocannabinoid signaling
    111158897
   04722 Neurotrophin signaling pathway
    111158897
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111158897
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111158897
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158897
   05231 Choline metabolism in cancer
    111158897
  09162 Cancer: specific types
   05210 Colorectal cancer
    111158897
   05212 Pancreatic cancer
    111158897
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111158897
   05012 Parkinson disease
    111158897
   05016 Huntington disease
    111158897
   05017 Spinocerebellar ataxia
    111158897
   05020 Prion disease
    111158897
   05022 Pathways of neurodegeneration - multiple diseases
    111158897
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111158897
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111158897
   04932 Non-alcoholic fatty liver disease
    111158897
   04931 Insulin resistance
    111158897
   04933 AGE-RAGE signaling pathway in diabetic complications
    111158897
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111158897
   05135 Yersinia infection
    111158897
   05133 Pertussis
    111158897
   05152 Tuberculosis
    111158897
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111158897
   05170 Human immunodeficiency virus 1 infection
    111158897
   05161 Hepatitis B
    111158897
   05171 Coronavirus disease - COVID-19
    111158897
   05162 Measles
    111158897
   05167 Kaposi sarcoma-associated herpesvirus infection
    111158897
   05169 Epstein-Barr virus infection
    111158897
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111158897
   05142 Chagas disease
    111158897
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111158897
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111158897
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111158897
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH RIO1 Kdo DUF5411 FTA2
Other DBs
NCBI-GeneID: 111158897
NCBI-ProteinID: XP_022376908
UniProt: A0A2Y9L645
LinkDB
Position
Unknown
AA seq 443 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNYKQEGKSHRIPQIIIINILIISLLNVFTPQKTLEEF
QDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKS
DCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKG
CVIFQGTDHIDQWNKVIEQLGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFP
SESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQ
LEEREHAIEEWKELIYKEVLDWEERSKNGVVKDQPSDAAVSSNATPSRSSSINDISSMST
EQTLASDTDSSLDASTGPLEGCR
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
acggtcctcaaacgttaccagcagttgaagccaatcggctccggagcccaaggaattgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttaccgtgaactcgtcctcttaaaatgtgtc
aatcataaaaattataaacaagaaggcaaaagtcatcgaatccctcagatcattatcatt
aacattttgataattagtttgttaaatgtgtttacaccacaaaagactctagaagaattt
caagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcacatg
gagctggaccatgaaaggatgtcctaccttctttaccagatgctctgtggtattaaacat
ctgcattcagctggtatcattcatagagacttgaagcctagcaacatcgtagtaaaatca
gactgcacgctcaagatccttgactttggcctggcccggacggcgtgtaccaacttcatg
atgactccatacgtggtgacgcgttattaccgggcgcctgaagtcatcctgggcatgggc
tacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaaggt
tgtgtgattttccaaggcactgatcatattgatcagtggaataaagtcattgagcagcta
ggaacaccgtctgcggattttatgaagaaactgcagccaaccgtgaggaattacgtagaa
aacagaccgaagtaccccggcatcaaattcgaagagctctttccagattggatattccca
tccgaatccgaacgagacaaaattaaaacaagtcaagccagagatttgttatcaaaaatg
ttggtgattgatcccgacaagcgaatctccgtggacgaagctttacgtcacccttatatt
actgtttggtatgaccctgctgaagccgaagcaccaccacctcagatttacgatgcccag
ctggaagaacgagagcatgcgattgaagagtggaaagagctgatttacaaggaagtgctg
gactgggaagagaggagcaagaacggcgtggtcaaagatcagccttcagatgcagcagta
agcagcaacgccactccgtcccggtcgtcgtccatcaacgacatctcgtccatgtccact
gagcagacgctggcctcagacacagacagcagcctcgacgcctccacgggacccctcgaa
ggttgccggtga

DBGET integrated database retrieval system