KEGG   Enhydra lutris kenyoni (northern sea otter): 111144883
Entry
111144883         CDS       T05871                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04010  MAPK signaling pathway
elk04060  Cytokine-cytokine receptor interaction
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04217  Necroptosis
elk04650  Natural killer cell mediated cytotoxicity
elk04668  TNF signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk04940  Type I diabetes mellitus
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05142  Chagas disease
elk05143  African trypanosomiasis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05320  Autoimmune thyroid disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111144883
   04668 TNF signaling pathway
    111144883
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111144883
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111144883
   04217 Necroptosis
    111144883
   04115 p53 signaling pathway
    111144883
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111144883
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144883
   05205 Proteoglycans in cancer
    111144883
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111144883
   05330 Allograft rejection
    111144883
   05332 Graft-versus-host disease
    111144883
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111144883
   05022 Pathways of neurodegeneration - multiple diseases
    111144883
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111144883
   04932 Non-alcoholic fatty liver disease
    111144883
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111144883
   05161 Hepatitis B
    111144883
   05160 Hepatitis C
    111144883
   05164 Influenza A
    111144883
   05162 Measles
    111144883
   05168 Herpes simplex virus 1 infection
    111144883
   05163 Human cytomegalovirus infection
    111144883
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144883
   05169 Epstein-Barr virus infection
    111144883
   05165 Human papillomavirus infection
    111144883
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111144883
   05143 African trypanosomiasis
    111144883
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111144883
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111144883
   04090 CD molecules [BR:elk04090]
    111144883
Cytokine receptors [BR:elk04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111144883
CD molecules [BR:elk04090]
 Proteins
  111144883
SSDB
Motif
Pfam: Death TNFR_c6 CcmH Stn1_C
Other DBs
NCBI-GeneID: 111144883
NCBI-ProteinID: XP_022355174
UniProt: A0A2Y9J628
LinkDB
Position
Unknown
AA seq 331 aa
MLQYLKLSCEISSAVSPGNARTAWQPRIFTSIAGPWPKAVSAQATAVNSKALRFHKNITI
RETGCSEGQRGENRVCCQPCPPGTRKEGDCESAGGASKCVACQEGEEYMEEKHFSDKCRR
CRICDGEHGLEVERNCTRSQNTKCRCKPNFFCNVSECEHCTPCTTCEHGVLENCTPTSNT
KCKEGSSSSFLWFCVLIPILMGALIYWWRLRRHRNKKTEDLESRPSNTEMMPIKYADVDL
NTYITTIAEQMKITEVREFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQVHGRKD
AYYNLLTGLRKAHLCELAERIQEIIQKDSTS
NT seq 996 nt   +upstreamnt  +downstreamnt
atgttacagtatttgaaactgtcgtgtgagatctccagtgctgtgagtcctggcaatgca
cggacagcttggcaacccaggatatttacctccattgctggaccatggcctaaagctgtc
agtgctcaagcaactgctgtcaactccaaggcattgagatttcataagaacattaccata
agggagacggggtgctcggaaggtcagcgtggtgagaacagagtctgctgtcagccatgt
cctcccggcacacggaaggagggtgactgtgaatctgcggggggcgcgtcaaaatgtgtg
gcctgccaggaaggggaggagtacatggaagagaagcatttttcggataaatgcagaaga
tgtcgaatttgtgacggagagcacgggttggaagtggagagaaactgtacccggagccag
aacaccaagtgcagatgtaaaccaaactttttttgtaacgtctctgagtgcgaacattgt
accccatgcaccacgtgtgaacatggagtccttgagaattgcacaccaaccagcaacacc
aaatgtaaagaaggatccagctccagctttctgtggttttgtgtcctaatcccgattcta
atgggtgcgctaatatattggtggaggttgagaaggcaccggaataaaaagactgaagac
ctggaatccagaccctcaaatactgaaatgatgccaataaaatacgcagacgtcgacctg
aatacctatataactactattgctgaacaaatgaaaataactgaagtcagagaatttgtt
cggaagaatggtatcaacgaagccaagatagatgaaattaagaatgataacctccaagac
acagcagaacaaaaagtccaactgctgcgtaattggtaccaagtccacgggaggaaagat
gcttattacaatttacttacaggcctcagaaaagcccatctttgtgaactagcagagaga
attcaagaaataatccagaaggacagtactagctaa

DBGET integrated database retrieval system