KEGG   Enhydra lutris kenyoni (northern sea otter): 111144961
Entry
111144961         CDS       T05871                                 

Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04114  Oocyte meiosis
elk04115  p53 signaling pathway
elk04218  Cellular senescence
elk04540  Gap junction
elk04914  Progesterone-mediated oocyte maturation
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111144961
   04114 Oocyte meiosis
    111144961
   04115 p53 signaling pathway
    111144961
   04218 Cellular senescence
    111144961
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111144961
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111144961
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111144961
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111144961
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111144961
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elk03032]
    111144961
   03036 Chromosome and associated proteins [BR:elk03036]
    111144961
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111144961
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111144961
    2.7.11.23  [RNA-polymerase]-subunit kinase
     111144961
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111144961
DNA replication proteins [BR:elk03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    111144961
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111144961
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111144961
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 111144961
NCBI-ProteinID: XP_022355303
UniProt: A0A2Y9J6H1
LinkDB
Position
Unknown
AA seq 297 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALNHPYFNDLDNQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtagccatgaagaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaagaacttcgtcat
ccaaatatagtcagtcttcaagatgtgcttatgcaggattccaggttatatctcattttt
gaattcctttccatggatcttaagaaatacttagattccatccctcctggtcagttcatg
gattcttcacttgttaagagttatttgtaccaaatcctgcaagggattgtgttttgccac
tccagaagagttctgcacagagacttaaaacctcaaaatctattgattgatgacaaagga
acaattaaactggctgattttggccttgccagagcttttggaatacctattagagtatac
acacatgaggtggtaacactctggtacagatctccggaagtattgctggggtcagctcgc
tactcgactccagttgacatttggagtataggcaccatatttgcagaattagcaaccaaa
aaaccacttttccacggggattcggaaatcgatcaactcttcagaattttcagagctttg
ggtactcccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaagtggaaaccaggaagtctggcatcccatgttaaaaacttggatgaaaatggc
ttggatctgctctcgaaaatgttagtctatgatcctgccaaacgaatttctggcaaaatg
gcactgaatcatccttattttaatgatttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system