KEGG   Enhydra lutris kenyoni (northern sea otter): 111144976
Entry
111144976         CDS       T05871                                 

Definition
(RefSeq) urokinase-type plasminogen activator isoform X1
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04064  NF-kappa B signaling pathway
elk04610  Complement and coagulation cascades
elk05202  Transcriptional misregulation in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111144976
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111144976
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111144976
   05206 MicroRNAs in cancer
    111144976
   05205 Proteoglycans in cancer
    111144976
  09162 Cancer: specific types
   05215 Prostate cancer
    111144976
Enzymes [BR:elk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     111144976
Peptidases and inhibitors [BR:elk01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111144976
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   111144976
SSDB
Motif
Pfam: Trypsin Kringle DUF316 Trypsin_2 EGF
Other DBs
NCBI-GeneID: 111144976
NCBI-ProteinID: XP_022355326
UniProt: A0A2Y9J496
LinkDB
Position
Unknown
AA seq 432 aa
MRILLTCLLLCALVVSDSEGSHELHPVSSASNCHCLNGGTCVSYKYFSNIHRCNCPKKFQ
GEHCEIDTTKTCFEGNGHSYRGKADTDIIGRPCLAWNSATVLLKEYHALRPDALQLGLGK
HNYCRNPNNRRSPWCYVQVGLKQLVRECMVPECSSGKNPLTPEKAEFQCGQKALRPRFKI
IGGEFTTIENQPWFAAIYRRHHGGSITYLCGGSLISPCWVLSATHCFINHPKKEDYIVYL
GRSKRNSGTPGEMMFEVEKLILHEDYNADNLAHHNDIALLKIRSNTGQCAQPSRSIQTIC
LPPVRGDANFGMSCEIAGFGKENDTDYLYPEQLKMTVVKLVSYQECQQPHYYGSEVTTKM
LCAADPQWETDSCQGDSGGPLVCSIQGRLTLTGIVSWGSGCAMKDKPGVYTRVSHFLPWI
HMHARQQNGLTL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagaatcctgctgacgtgcctgctcctctgtgccctagtggtgagcgactccgaagga
agccatgaacttcacccagtgtctagtgcatcaaactgccattgtctgaatggaggaaca
tgtgtgtcctacaagtacttctccaacattcatcgatgcaactgtccaaagaaattccaa
ggggaacactgcgagatagatacaacgaaaacctgctttgaggggaatggtcactcttac
cgagggaaggccgacactgacatcataggccggccctgcctggcctggaactctgccact
gttcttctgaaagagtaccacgccctcagacccgatgcccttcagctgggcctgggcaaa
cacaactactgcaggaacccaaacaaccgtagaagtccttggtgctatgtgcaggttggc
ctaaagcagcttgtccgggagtgcatggtgccagaatgctcttctggaaaaaatcccctc
actccagaaaaagctgagtttcaatgtggccagaaggctctgaggcctcgctttaagatt
attggcggagaattcaccaccatcgagaaccagccgtggtttgccgccatctacaggagg
caccacggaggctctatcacctacctgtgtggtggcagcctcatcagtccttgctgggtg
ctcagcgccacacactgcttcattaatcacccgaagaaggaggactacattgtctacctg
ggtcggtcgaagcgtaactccgggacacctggggagatgatgtttgaggtggagaagctc
atcttgcatgaggactacaatgctgacaaccttgctcaccacaatgatattgccctgctg
aagatccgctccaacacgggccagtgtgcacagccatccaggtccatacaaaccatctgc
ctgcctccagtgcgtggagatgctaattttggcatgagctgtgagatcgctggctttgga
aaagagaatgacactgactatctctatccagagcagctaaaaatgactgttgtgaagctg
gtttcctaccaggagtgtcagcagccacactactatggctccgaagttaccaccaaaatg
ctgtgtgccgctgacccacagtgggaaacagattcctgccagggagactccgggggcccc
ctggtctgctctatccaaggccgcctgactctgacggggattgtgagctggggcagtggt
tgtgccatgaaggacaagccaggcgtctacacaagggtctcacacttcctgccttggatc
cacatgcacgccaggcaacagaatggcctaaccctctga

DBGET integrated database retrieval system