KEGG   Enhydra lutris kenyoni (northern sea otter): 111145111
Entry
111145111         CDS       T05871                                 

Definition
(RefSeq) apoptosis-inducing factor 2 isoform X1
  KO
K22745  apoptosis-inducing factor 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111145111
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO K_oxygenase GIDA Thi4 Lycopene_cycl NAD_binding_8 AlaDh_PNT_C Trp_halogenase FAD_binding_2 HI0933_like FAD_oxidored DUF4147 NAD_binding_7 RMI2 Abhydrolase_3 FAD_binding_3 StbA
Other DBs
NCBI-GeneID: 111145111
NCBI-ProteinID: XP_022355467
UniProt: A0A2Y9JCH5
LinkDB
Position
Unknown
AA seq 373 aa
MGSQVSVDVGAVRVVIVGGGFGGIAAASQLQTLNIPFVLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKENFRQGLVVEIDLQNQTVLLEDGEALPFSHLILATGSTGLFPGKFN
KVSSREAAIQAYEDMVKQVQRSQSVVVVGGGSAGVEMAAEVKTEFPEKKVTLIHAQVALA
DKELLPCVRQEAKEILLQKGVQLLLSERVSNLEDLPLNEYQECIQVRTDKGTEVATNLVI
VCNGIKINSSAYHSSFESHLASNGALRVNEHLQVEGCSRVYAIGDCADVKEPKMAYHAGL
HASVAVANIVNSMKQRPLKAYKPGALTFLLAMGRNDGVGQISGFYVGRLMVRLAKSRDLF
VSSSWKTMRQSPP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgggttcccaggtgtccgtggacgtgggagccgtgcgtgtggtgatcgtgggtgggggc
tttggcgggatagctgctgccagccagctgcagactctgaacatccccttcgtgctggtg
gacatgaaggactccttccaccacaacgtggcagccctgcgggcctccgtggaaagtggg
tttgccaaaaagacattcatctcctactccgtgacctttaaggagaacttccggcagggg
ctggtggtggagatagacctgcagaatcagacagtgctgctcgaggacggcgaggccctg
cccttctcacatcttatcctggccactggcagcaccgggctctttccaggcaagtttaac
aaggtttccagccgggaggctgctatccaggcctacgaggacatggtgaagcaggtccag
cgctcccagtcggtggtggtggtgggaggcggttctgccggagtggaaatggcagccgag
gttaaaaccgaattccccgagaaaaaggtcactctcatccacgcccaggtggcccttgcc
gacaaggagctcctgccctgtgttcggcaggaagcgaaggagatcctgctgcagaaaggc
gttcagctgctgctgagtgagcgcgtgagcaacctggaggatttgcctctgaacgagtat
caggagtgcatccaggtgcgcacggacaaaggcacagaggtggccaccaacttggtgatc
gtctgcaacggtattaagatcaacagctcagcctaccacagttcgttcgagagtcacctg
gccagcaacggtgctctgcgagtgaacgagcatctccaggtggaaggctgcagccgcgtc
tacgccattggcgactgtgccgatgtgaaggagcccaagatggcctatcacgccggcctc
catgccagcgtggctgtggccaacattgtcaactccatgaaacagaggccccttaaggcc
tacaagccaggggcactgacgttccttctggccatggggagaaacgatggtgtgggccag
atcagtggcttctacgtggggcgactcatggttcggctggccaagagccgggacctattc
gtctcctccagctggaagaccatgcggcagtctccaccttga

DBGET integrated database retrieval system