KEGG   Enhydra lutris kenyoni (northern sea otter): 111145476
Entry
111145476         CDS       T05871                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04064  NF-kappa B signaling pathway
elk04071  Sphingolipid signaling pathway
elk04141  Protein processing in endoplasmic reticulum
elk04210  Apoptosis
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04668  TNF signaling pathway
elk04920  Adipocytokine signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05160  Hepatitis C
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111145476
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111145476
   04064 NF-kappa B signaling pathway
    111145476
   04668 TNF signaling pathway
    111145476
   04071 Sphingolipid signaling pathway
    111145476
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111145476
   04217 Necroptosis
    111145476
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111145476
   04622 RIG-I-like receptor signaling pathway
    111145476
   04657 IL-17 signaling pathway
    111145476
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111145476
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111145476
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111145476
   05203 Viral carcinogenesis
    111145476
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111145476
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111145476
   05014 Amyotrophic lateral sclerosis
    111145476
   05016 Huntington disease
    111145476
   05017 Spinocerebellar ataxia
    111145476
   05022 Pathways of neurodegeneration - multiple diseases
    111145476
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111145476
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111145476
   05135 Yersinia infection
    111145476
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111145476
   05160 Hepatitis C
    111145476
   05168 Herpes simplex virus 1 infection
    111145476
   05163 Human cytomegalovirus infection
    111145476
   05167 Kaposi sarcoma-associated herpesvirus infection
    111145476
   05169 Epstein-Barr virus infection
    111145476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111145476
   04121 Ubiquitin system [BR:elk04121]
    111145476
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111145476
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111145476
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111145476
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF MATH SlyX Fibin Tropomyosin_1 DUF1664 Spc7 TMPIT
Other DBs
NCBI-GeneID: 111145476
NCBI-ProteinID: XP_022356080
UniProt: A0A2Y9JE68
LinkDB
Position
Unknown
AA seq 347 aa
MVQVLRLHTPLCTPPSVDARKLRVCFQDHVRACGKCRTPCRFHVVGCPELVESEKQQQHE
AHWLREHLAMLLGGLLEAKPLSGAGGHFLSQSEVGGWEASTLHPEAGLPKAAELQQRCEA
LERKTATFENIVCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSISLKDLA
MAELEQKVHEMEATTFDGVFIWKICDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRI
YLNGDGTGRGTHLSLFFVVMKGPHDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSS
SFQRPISDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggtgcaggtcctcaggctgcacactcccctctgcacacctccctctgttgacgcccgc
aagctgcgcgtgtgcttccaggaccatgtcagggcgtgtggcaagtgccggaccccgtgc
aggttccatgtcgtcggctgccccgagttggtggagagcgagaagcagcagcaacatgag
gcccactggctccgggagcacttggccatgctgctgggcggcctcctggaggccaagccc
ctctctggggcagggggccacttcctgagccagagcgaggtggggggctgggaagccagc
acgctgcaccccgaggcagggctccccaaggctgcggagctgcagcagcggtgcgaggcc
ctggagaggaagaccgccacctttgagaacatcgtctgcgtcctgaaccgagaggtggag
agggtggccatgaccgccgaggcctgtggccggcagcaccggctggaccaggacaggatc
gaggccctgagtaacaaggtacagcagctggagaggagcatcagtctgaaggacctggcg
atggcggagctggagcagaaggtccatgagatggaggcgaccaccttcgacggcgtgttc
atctggaagatctgtgacttcgccaggaagcggcaggaggccgtggccggccgcacgccc
gccatcttctccccagccttctacacgagcaggtacggctacaagatgtgtctgcgcatc
tacttgaacggagacggcaccgggcgcgggacacacctgtcactcttctttgtggtgatg
aagggcccccacgacgcactcctgcgctggcccttcaaccagaaggtcaccttaatgctg
ctcgaccagaacaaccgggagcacgtgattgatgcctttagacccgacgtgacctcatcc
tctttccagaggccaatcagtgacatgaacattgccagtggctgccccctcttctgccct
gtctccaagatggaggccaagaactcctacgtgcgcgatgatgccatctttatcaaagcc
atcgtggacctgacggggctctag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111146100
Entry
111146100         CDS       T05871                                 

Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04064  NF-kappa B signaling pathway
elk04071  Sphingolipid signaling pathway
elk04141  Protein processing in endoplasmic reticulum
elk04210  Apoptosis
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04668  TNF signaling pathway
elk04920  Adipocytokine signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05160  Hepatitis C
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111146100
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111146100
   04064 NF-kappa B signaling pathway
    111146100
   04668 TNF signaling pathway
    111146100
   04071 Sphingolipid signaling pathway
    111146100
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111146100
   04217 Necroptosis
    111146100
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111146100
   04622 RIG-I-like receptor signaling pathway
    111146100
   04657 IL-17 signaling pathway
    111146100
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111146100
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111146100
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146100
   05203 Viral carcinogenesis
    111146100
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111146100
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111146100
   05014 Amyotrophic lateral sclerosis
    111146100
   05016 Huntington disease
    111146100
   05017 Spinocerebellar ataxia
    111146100
   05022 Pathways of neurodegeneration - multiple diseases
    111146100
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111146100
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111146100
   05135 Yersinia infection
    111146100
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111146100
   05160 Hepatitis C
    111146100
   05168 Herpes simplex virus 1 infection
    111146100
   05163 Human cytomegalovirus infection
    111146100
   05167 Kaposi sarcoma-associated herpesvirus infection
    111146100
   05169 Epstein-Barr virus infection
    111146100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111146100
   04121 Ubiquitin system [BR:elk04121]
    111146100
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111146100
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111146100
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    111146100
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-RING_UBOX zf-RING_6 zf-RING_2 MATH SlyX Tropomyosin_1 zf-C3HC4_5
Other DBs
NCBI-GeneID: 111146100
NCBI-ProteinID: XP_022357193
UniProt: A0A2Y9J895
LinkDB
Position
Unknown
AA seq 723 aa
MAGVGGKVASGVRSAHGSRQSGLGDLEGGRWVWRLRVGVLSLGPVRASVGLAAPGSSGVL
GATPPPSTAVQPRPLTAGQGLWPRRWGPSKDPPHPVTCSLFFPRARRCAALMAAAGATPP
GSLDLLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSSCLTSILSSGPQNC
AACVHEGIYEEGVSILESGSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYECWAFAPT
AKPVARVGDTASMFPAREQRVSGPPAAFKCTTAKLAGEALKTQSLRRAPRPMAAPAQSSV
QMLSPRQTASSCSGPVQNFPLTSCHEGRCPFTLTECPACKGLVRLGEKERHSEHECPERS
LSCRHCRAPCCWADMKAHHEVCPKFPLTCDGCGKKKISREKFQDHVRACGKCRTPCRFHV
VGCPELVESEKQQQHEAHWLREHLAMLLGGLLEAKPLSGAGGHFLSQSEVGGWEASTLHP
EAGLPKAAELQQRCEALERKTATFENIVCVLNREVERVAMTAEACGRQHRLDQDRIEALS
NKVQQLERSISLKDLAMAELEQKVHEMEATTFDGVFIWKICDFARKRQEAVAGRTPAIFS
PAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPHDALLRWPFNQKVTLMLLDQN
NREHVIDAFRPDVTSSSFQRPISDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL
TGL
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggccggtgttggcgggaaggtggcatccggcgtgcgctctgcccatgggtcacggcag
agtgggctgggtgaccttgagggcggccggtgggtgtggaggctccgggtgggcgtgctg
agcctcggccctgtgcgtgcgtcggttgggctggcggctcccggttcctccggagtgctg
ggtgccactcctccaccctccaccgccgttcagcccagacccctcactgccgggcagggg
ctgtggccccgccgttggggcccgtccaaggaccccccccaccccgtgacctgctctctg
ttcttccccagggcgcggcggtgcgcggctctcatggctgcggccggcgcgacccctccc
ggctccctagacctgctgcagcccggcttctccaagaccctcctggggaccaagccggag
gacaagtacctgtgctcggcctgcaggaacgtgctgcgcaggcctttccaggcacagtgc
ggccaccgctactgctcctcctgtctgaccagcatcctcagctccgggcctcagaactgc
gccgcctgcgttcacgagggcatatatgaggaaggcgtctctattttggaaagcggttcg
gctttcccagacaacgctgcgcgcagggaggtggagagcctgccggctgtctgtcccagt
gacggctgcacctggaaggggacccttaaagagtatgagtgctgggcttttgccccaaca
gccaagcctgtggcacgggttggagacacggccagcatgttccccgcccgggaacagcgc
gtctcaggccctcctgctgccttcaaatgcaccacggccaagcttgcgggggaagccctg
aagacccagtccctccggagggcaccgcgccccatggctgccccagcccagagctctgtg
cagatgctgagcccacggcagacggcttcctcctgctctggaccagtccagaactttcct
ctcacgagctgccatgaaggacgctgcccgttcacgctgaccgagtgcccggcgtgcaaa
ggcctggtccgccttggggagaaggagcgtcactcagagcacgagtgcccggagagaagc
ctcagctgccggcactgccgggcgccctgctgctgggcagacatgaaggcgcatcacgaa
gtctgtcccaagttccccttgacttgcgacggctgtggcaagaagaagatctcacgggag
aaattccaggaccatgtcagggcgtgtggcaagtgccggaccccgtgcaggttccatgtc
gtcggctgccccgagttggtggagagcgagaagcagcagcaacatgaggcccactggctc
cgggagcacttggccatgctgctgggcggcctcctggaggccaagcccctctctggggca
gggggccacttcctgagccagagcgaggtggggggctgggaagccagcacgctgcacccc
gaggcagggctccccaaggctgcggagctgcagcagcggtgcgaggccctggagaggaag
accgccacctttgagaacatcgtctgcgtcctgaaccgagaggtggagagggtggccatg
accgccgaggcctgtggccggcagcaccggctggaccaggacaggatcgaggccctgagt
aacaaggtacagcagctggagaggagcatcagtctgaaggacctggcgatggcggagctg
gagcagaaggtccatgagatggaggcgaccaccttcgacggcgtgttcatctggaagatc
tgtgacttcgccaggaagcggcaggaggccgtggccggccgcacgcccgccatcttctcc
ccagccttctacacgagcaggtacggctacaagatgtgtctgcgcatctacttgaacgga
gacggcaccgggcgcgggacacacctgtcactcttctttgtggtgatgaagggcccccac
gacgcactcctgcgctggcccttcaaccagaaggtcaccttaatgctgctcgaccagaac
aaccgggagcacgtgattgatgcctttagacccgacgtgacctcatcctctttccagagg
ccaatcagtgacatgaacattgccagtggctgccccctcttctgccctgtctccaagatg
gaggccaagaactcctacgtgcgcgatgatgccatctttatcaaagccatcgtggacctg
acggggctctag

DBGET integrated database retrieval system