KEGG   Enhydra lutris kenyoni (northern sea otter): 111145587
Entry
111145587         CDS       T05871                                 

Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04072  Phospholipase D signaling pathway
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111145587
   04015 Rap1 signaling pathway
    111145587
   04072 Phospholipase D signaling pathway
    111145587
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111145587
   05231 Choline metabolism in cancer
    111145587
  09162 Cancer: specific types
   05210 Colorectal cancer
    111145587
   05212 Pancreatic cancer
    111145587
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 111145587
NCBI-ProteinID: XP_022356265
UniProt: A0A2Y9JEQ5
LinkDB
Position
Unknown
AA seq 985 aa
MAWSQWEFLALPVTGAGLTAALMTPGLGTRALDPSGQAGTLTGRLAEGLLQSSPLPGSRA
TMAREAGPTAPRARKGWVFFACVSVVTARRRATAHRATLQSPTRWPAPVPAAATESCTQE
IGEELLNGVIYSISLRKVQAQPGANKGQRWLGCENESALSLYETCKVRTVKAGTLEKLVE
HLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRRDALTASSRYGCILPYSDED
GGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLA
QLERAEPVQAEPEALSPASAPAPVPETAPELEPALAPTLLPTPEPDAAPARTPEPDAAPA
SALEPDVAPAPAPTPEPDAAPAPALEPDAAPAPTLEADAALAPAPEPDTALAPAPEPKPS
LSQTLEPETAPAPEPPWPSVVAAENGLNEKPHLLAFPPDLVAEQFTLMDAELFKKVVPYH
CLGSIWSQRDKKGKEHLAPSVRATVAQFNSVANCVITTCLGDRSVTARGRARVVEHWIEV
ARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSRESFRIFQKLSEIFSDENNYSLSR
ELLIKEGTSKFATLEMNPKRAQKRPKEMGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRL
INFEKRRKEFEVIAQIKLLQSACNSYSIVPEEHFRAWFRAMERLSETESYNLSCELEPPS
ESASNTLKAKKNAAIVKRWSDRQAPSGELSTSGSSHSKSCDQLRCGPYLSSGDIADALSV
HSAGSSSSDVEEINMSFVPESPDGQEKKFWESTSQSSPETSGISSASSSTSSSSASTTPV
AATRTHKRSVSGVCGCSSSLPLYNQQVGDCCIIRVSLDVDNGNLYKSILVTSQDKAPAVI
RKAMDKHNLDEDEPDDYELVQVISDDRKLKIPDNANVFYAMNSTANYDFVLKKRTFTKGA
KVRHGTSSTLPRMKQKGLKIAKGIF
NT seq 2958 nt   +upstreamnt  +downstreamnt
atggcctggtcccagtgggaattcctggccctgcccgtcacgggagcaggtctgacagcc
gcattgatgacaccgggcctaggcactcgggcgcttgatccatcggggcaggcaggcacg
ctgacgggcagactggcagagggcctcctccagagctcacccctgcctggctcccgtgcc
accatggcccgggaagccgggcccactgcccccagggccaggaagggctgggtgttcttt
gcctgtgtctctgtggtgacggccaggcgcagggccaccgcccaccgcgccactctccaa
agccccacacgttggccggcacctgtgccagcagcagccaccgagagctgcacgcaggag
atcggtgaggagctgctcaacggtgtcatctactccatctccctgcggaaggtgcaggcc
cagcccggagccaacaaaggccagcgctggcttgggtgtgaaaacgagtccgccctgagc
ctgtatgagacctgcaaggtacggacggtgaaggcaggcacgctggagaagctggtggaa
cacctggtgcccgccttccagggcagtgacctctcctacgtcaccatctttctatgcacc
taccgggccttcaccaccacccagcaggtcctggaccttctgttcaaacggtacggtaga
cgtgacgccctcacggcctcctctagatacggatgtatcctcccttactctgacgaggac
ggcggcccccaggaccaattaaaaaatgccatctcctccattctgggcacctggctggac
cagtactcggaggacttctgtcagcccccagactttccctgcctcaagcagctggtggcc
tatgtgcagctcaacatgcccggctctgacctggagcgccgtgcccaccttctgctggcc
cagctggagcgcgcagagcccgtgcaggcagagcccgaggctctgtcccctgcttcagct
ccagcaccagttccagaaacagctccagaactagagccagctttagcaccaactctcctg
cctactccggagccagacgcagctccagcacgaactccagagccagacgcagctccggct
tctgctctagaaccagatgtggctccggctccggctcccactccagagccagatgcagct
ccagctcccgctctagaaccagacgcagctccggctcccactctagaagcagacgcggct
ctggctcccgctccagaaccagacacggctctggctcccgctccagaacccaagccatct
ctgtctcaaactctagagccagagacagctccagcgcctgagcctccctggccttcagtt
gtggctgcagaaaatgggctgaatgagaagcctcacctcttggccttccctcctgacctg
gtggcagagcagtttaccctaatggatgcagagctgttcaagaaggtggtgccctaccac
tgcctgggctccatctggtcccagcgagacaagaagggcaaggagcacctggctccctcc
gtccgtgccaccgtcgcccagttcaacagcgtggccaactgcgtcatcaccacctgcctg
ggggaccggagtgtgacggcccggggcagggcccgggtggtggagcactggatcgaggtg
gccagggagtgccgcgtcctcaagaatttctcgtcactctacgccatcctgtccgccctg
cagagcaactccatccaccggctgaagaagacgtgggaagaagtttccagggaaagcttc
cgaatcttccagaagctgtcagaaatcttctccgatgagaacaactactcgctgagcaga
gagctgctcatcaaggaggggacctccaagtttgccaccctggagatgaaccccaagaga
gcgcaaaagcggccgaaggagatgggcgtcatccagggcaccgttccctacctgggcacg
ttcctcacagacctggtgatgctggacaccgcaatgaaggactatctgtatgggagactg
atcaacttcgagaagaggaggaaggaattcgaagtgatcgcccagatcaagctgctccag
tcggcgtgtaacagttacagcatcgtgcccgaggagcacttccgggcctggttccgggcc
atggagcggctcagcgagacggagagctacaacctgtcgtgtgagctggagcccccctcc
gagtcggccagcaacaccctcaaggccaagaagaacgcggccatcgtcaagcgctggagc
gaccgccaggcccccagcggggagctcagtaccagcggcagctcccactccaagtcctgc
gaccagctcaggtgcggcccctacctcagcagcggggacattgccgacgccctcagcgtc
cactcggccggctcgtccagctccgacgtggaggagatcaacatgagctttgtcccggag
tcccccgacggtcaggaaaaaaagttctgggagtcgacctcccagtcgtccccggagacc
tccggcatcagttcggcctccagcagcacgtcctcctcctcggcctccaccacacccgtg
gccgccacacgcacccacaagcgctccgtgtccggggtgtgcggctgcagctcctcgctg
cctctctacaaccagcaggtgggcgactgctgcatcatccgcgtcagcctggacgtggac
aacggcaacttgtacaagagcatcctggtaaccagccaagataaggctccagccgtcatc
cgcaaggccatggacaaacacaacctggacgaggacgagccggacgactacgagctagtg
caggttatctccgacgatcggaagctgaagatccctgacaacgccaacgtgttctacgcc
atgaactcaacggccaactatgactttgtcctcaagaaacggaccttcacaaagggggca
aaggtcaggcacggcaccagctcgactctgcctcgcatgaagcagaagggactcaagatt
gccaagggcatcttctag

DBGET integrated database retrieval system