KEGG   Enhydra lutris kenyoni (northern sea otter): 111145625
Entry
111145625         CDS       T05871                                 

Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04066  HIF-1 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111145625
   04066 HIF-1 signaling pathway
    111145625
   04151 PI3K-Akt signaling pathway
    111145625
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111145625
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111145625
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111145625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111145625
Cytokines and growth factors [BR:elk04052]
 Cytokines
  CSF and other factors
   111145625
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111145625
NCBI-ProteinID: XP_022356364
UniProt: A0A2Y9J9L7
LinkDB
Position
Unknown
AA seq 192 aa
MGVCECPALLLLLSLLLLPLGLPVLGGPPRLICDSRVLERYILEAREAENVTMGCAQGCS
FSENITVPDTKVNFYTWKRMDVGQQAVEVWQGLALLSEAILRGQALLANASQPSETLQLH
VDKAVSSLRSLTSLLRALGAQKEASSLPEEASAAPLRTFTVDTLCKLFRIYSNFLRGKLT
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgtgcgaatgtcctgccctgttgcttctgctgtctttgctgctgcttcctctg
ggcctcccagtcctgggcggcccccctcgcctcatctgtgacagccgagtcctggagaga
tatatcctggaggcccgggaggcagaaaatgtcacgatgggctgtgctcaaggctgcagc
ttcagtgagaatatcaccgtcccagacaccaaggttaatttctacacctggaagaggatg
gacgtcgggcagcaggccgtggaagtctggcagggcctggctctgctctcggaagccatc
ctgcggggccaggccctgttggccaacgcctcgcagccgtctgagaccctgcagctgcat
gtggacaaagccgtcagtagcctacgcagcctcacctccctgctgcgggcgctgggagcc
cagaaggaggccagctcccttccagaggaagcttctgctgctccactccgaacattcact
gttgatactttgtgcaaacttttccgaatctactccaatttcctgcggggcaagctgacg
ctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system