KEGG   Enhydra lutris kenyoni (northern sea otter): 111145636
Entry
111145636         CDS       T05871                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04071  Sphingolipid signaling pathway
elk04145  Phagosome
elk04151  PI3K-Akt signaling pathway
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04520  Adherens junction
elk04530  Tight junction
elk04620  Toll-like receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04810  Regulation of actin cytoskeleton
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04972  Pancreatic secretion
elk05014  Amyotrophic lateral sclerosis
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05100  Bacterial invasion of epithelial cells
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05231  Choline metabolism in cancer
elk05416  Viral myocarditis
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111145636
   04014 Ras signaling pathway
    111145636
   04015 Rap1 signaling pathway
    111145636
   04310 Wnt signaling pathway
    111145636
   04370 VEGF signaling pathway
    111145636
   04071 Sphingolipid signaling pathway
    111145636
   04024 cAMP signaling pathway
    111145636
   04151 PI3K-Akt signaling pathway
    111145636
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111145636
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111145636
   04520 Adherens junction
    111145636
   04530 Tight junction
    111145636
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111145636
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111145636
   04650 Natural killer cell mediated cytotoxicity
    111145636
   04662 B cell receptor signaling pathway
    111145636
   04664 Fc epsilon RI signaling pathway
    111145636
   04666 Fc gamma R-mediated phagocytosis
    111145636
   04670 Leukocyte transendothelial migration
    111145636
   04062 Chemokine signaling pathway
    111145636
  09154 Digestive system
   04972 Pancreatic secretion
    111145636
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111145636
  09158 Development and regeneration
   04360 Axon guidance
    111145636
   04380 Osteoclast differentiation
    111145636
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111145636
   05205 Proteoglycans in cancer
    111145636
   05203 Viral carcinogenesis
    111145636
   05231 Choline metabolism in cancer
    111145636
  09162 Cancer: specific types
   05210 Colorectal cancer
    111145636
   05212 Pancreatic cancer
    111145636
   05211 Renal cell carcinoma
    111145636
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111145636
   05020 Prion disease
    111145636
   05022 Pathways of neurodegeneration - multiple diseases
    111145636
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111145636
   05416 Viral myocarditis
    111145636
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111145636
   04933 AGE-RAGE signaling pathway in diabetic complications
    111145636
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111145636
   05135 Yersinia infection
    111145636
   05100 Bacterial invasion of epithelial cells
    111145636
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111145636
   05163 Human cytomegalovirus infection
    111145636
   05167 Kaposi sarcoma-associated herpesvirus infection
    111145636
   05169 Epstein-Barr virus infection
    111145636
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111145636
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111145636
   04031 GTP-binding proteins [BR:elk04031]
    111145636
Membrane trafficking [BR:elk04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    111145636
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    111145636
  Macropinocytosis
   Ras GTPases
    111145636
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    111145636
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111145636
  Exosomal proteins of other body fluids (saliva and urine)
   111145636
  Exosomal proteins of colorectal cancer cells
   111145636
  Exosomal proteins of bladder cancer cells
   111145636
GTP-binding proteins [BR:elk04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111145636
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 111145636
NCBI-ProteinID: XP_022356389
UniProt: A0A2Y9J9P1
LinkDB
Position
Unknown
AA seq 211 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVAETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatacatccccactgtctttgacaactac
tctgcgaatgttatggtagatggaaaaccggtgaacttgggcttatgggatacagctgga
caagaagattatgaccgattacgtcccttatcctatccgcaaacagttgcagaaacgtat
ggtaaggatataacgtccaggggcaaagacaagccgattgccgatgtattcttaatttgc
ttttctcttgtgagtcctgcatcatttgaaaatgttcgagcaaagtggtaccccgaagtg
cgacaccactgtcccaacacccccatcatcttggtggggactaaacttgatctcagggac
gacaaagacacgatcgagaagctgaaggaaaagaagctgactcctatcacctacccgcag
ggtctggccatggctaaggagatcggtgcggtaaaatacctggagtgctcagcgctcacg
cagcgaggcctcaagacagtgtttgacgaagcgatccgagcggttctctgcccccctccc
gtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system