KEGG   Enhydra lutris kenyoni (northern sea otter): 111145849
Entry
111145849         CDS       T05871                                 

Definition
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04066  HIF-1 signaling pathway
elk04115  p53 signaling pathway
elk04218  Cellular senescence
elk04371  Apelin signaling pathway
elk04390  Hippo signaling pathway
elk04610  Complement and coagulation cascades
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111145849
   04371 Apelin signaling pathway
    111145849
   04066 HIF-1 signaling pathway
    111145849
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111145849
   04218 Cellular senescence
    111145849
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111145849
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111145849
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111145849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111145849
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111145849
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111145849
Peptidases and inhibitors [BR:elk01002]
 Peptidase inhibitors
  Family I4: serpin family
   111145849
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111145849
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   111145849
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 111145849
NCBI-ProteinID: XP_022356832
UniProt: A0A2Y9J7A7
LinkDB
Position
Unknown
AA seq 400 aa
MQMSTVCLALGLALVFGEASASYLHETRAAELATDFGVKVFKQVAQASKDRNMVFSPYGV
ASVLAMLQLTTAGETRQQIQEAMRFQIDEKGMAPALRQLYKELMGPWNKDDISTADAIFV
QRDLKLVHGFMPYFFRLFRTTVKQVDFSEVERARFIVNDWVKRHTKGMIGNLLGRGTVDQ
LTRLMLVNALYFKGQWKTPFPKSGTHHRLFHKSDGSTVSVPMMAQTNKFNYTEFSTPDGH
YYDILELPYHGDMLSMFIAAPYEKDVPLSALTNILDAQLISQWKGNMTRRLRLLVLPKFS
LESEVNLRGPLENLGMTDMFRPNQADFSSLSDQEALYVSQALQKVKIEVNESGTVASSST
AIIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgcagatgtctacagtctgccttgccctgggcctggcccttgtctttggtgaagcatcg
gcctcctacctccacgagactcgggcagcggaactggccacagacttcggagtgaaagtg
tttaagcaggtggcacaggcctccaaggaccgcaacatggttttctccccctatggggtg
gcctctgtcctggccatgttgcagctgaccacagcaggagagacacggcagcaaatccaa
gaggccatgcggttccagattgatgagaagggcatggcacctgccctccgccagctgtac
aaggaactcatggggccgtggaacaaggacgacatcagcactgcggacgccatcttcgtc
cagcgggatctgaagctggttcacggcttcatgccctacttcttcaggctgttccgaacc
acagtcaagcaggtggacttctcagaggtggagagagccaggttcatcgtcaacgactgg
gtgaagcgacacacaaaaggcatgattggcaacctgctgggcagagggactgtggaccag
ctaacgcgcctgatgctggtgaatgccctctacttcaaaggccagtggaagacccccttc
cccaagtcaggcacccaccaccgcctcttccacaaatctgatggcagcaccgtctctgtg
cccatgatggctcagaccaacaagttcaactacaccgagttttctacccccgacggccat
tattacgacatcctggaactgccctatcacggagacatgctcagcatgttcattgctgct
ccctatgaaaaagacgtgcctctttctgccctcaccaacatcctggatgcccagctcatc
agccagtggaaagggaatatgaccagacggctccgcctcctggttctgcccaagttctcc
ctggagagcgaagtcaacctccggggacccctggagaacttggggatgactgacatgttc
aggccaaaccaggcagacttctccagtctttcagatcaagaggcactgtacgtgtcccag
gcgctgcagaaagtaaagatcgaggtgaacgagagcggcacggtggcgtcctcctctaca
gccatcatcgtctcagctcgaatggcccccgaggagatcatcatggacagacccttcctc
ttcgtggtgcggcacaaccccacaggaacggttcttttcatgggccaagtgatggaaccc
tga

DBGET integrated database retrieval system