KEGG   Enhydra lutris kenyoni (northern sea otter): 111146039
Entry
111146039         CDS       T05871                                 

Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03320  PPAR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04659  Th17 cell differentiation
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04932  Non-alcoholic fatty liver disease
elk04976  Bile secretion
elk05160  Hepatitis C
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05216  Thyroid cancer
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111146039
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111146039
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111146039
   03320 PPAR signaling pathway
    111146039
   04919 Thyroid hormone signaling pathway
    111146039
   04928 Parathyroid hormone synthesis, secretion and action
    111146039
  09154 Digestive system
   04976 Bile secretion
    111146039
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146039
   05202 Transcriptional misregulation in cancer
    111146039
  09162 Cancer: specific types
   05226 Gastric cancer
    111146039
   05216 Thyroid cancer
    111146039
   05222 Small cell lung cancer
    111146039
   05223 Non-small cell lung cancer
    111146039
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111146039
  09172 Infectious disease: viral
   05160 Hepatitis C
    111146039
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111146039
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:elk03310]
    111146039
Transcription factors [BR:elk03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111146039
Nuclear receptors [BR:elk03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111146039
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 111146039
NCBI-ProteinID: XP_022357118
UniProt: A0A2Y9J820
LinkDB
Position
Unknown
AA seq 439 aa
MAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
ALGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVDANMGLNPNSPND
PVTNICQAADKQLFTLVEWAKRVPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLETYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccctccctgggcccgggcatcggttcctctctcggctcc
ccaggacagctgcactcgcccatcagcaccctgagctcccccatcaacggcatgggccca
cccttctcggtcatcagctcccccatgggcccccactccatgtcagtgcccaccacgcct
gccctgggcttcagcacgggcagcccccagctcagctcacccatgaaccccgtcagcagc
agcgaggacatcaagccccccctgggcctcaatggtgtcctcaaagtcccggcccacccc
tcagggaacatggcgtccttcactaagcacatctgtgccatctgtggggaccgctcctca
ggcaagcactacggggtctacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacgtgccgggacaacaaggactgcctgattgacaagcgacag
cggaaccgctgtcagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaa
gccgtacaggaggagagacagcggggcaaggacaggaacgagaacgaggtggagtccacg
agcagcgccaacgaggacatgccggtggagaagattctggaggcggagctggctgtcgag
cccaagaccgagacgtatgtggacgcaaacatggggctgaaccccaactcgcccaacgac
cccgtcaccaacatctgtcaggccgcggacaagcagctcttcacgctggtcgagtgggcc
aagcgggtcccgcacttctctgagctgcccttggacgaccaggtcatcctgctgagggca
ggctggaatgagctgctcatcgcctccttctcccaccggtccatcgccgtgaaggacggg
atcctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgcgggggtgggc
gccatctttgacagggtgttgacggagctcgtgtccaagatgcgggacatgcagatggac
aagacggagctgggctgcctgcgcgccatcgtcctcttcaaccccgactccaaggggctc
tcgaacccggcagaggtggaggcgcttcgagagaaggtgtacgcgtcgctggagacctac
tgcaagcacaagtacccagagcagccaggaaggttcgccaagctgctgctgcgcctgccg
gccctgcgctcgatcggcctcaagtgcctggaacatctcttcttcttcaaactcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaagccccccaccaaatgacttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111151020
Entry
111151020         CDS       T05871                                 

Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03320  PPAR signaling pathway
elk04659  Th17 cell differentiation
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05216  Thyroid cancer
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111151020
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111151020
   03320 PPAR signaling pathway
    111151020
   04919 Thyroid hormone signaling pathway
    111151020
   04928 Parathyroid hormone synthesis, secretion and action
    111151020
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111151020
   05202 Transcriptional misregulation in cancer
    111151020
  09162 Cancer: specific types
   05226 Gastric cancer
    111151020
   05216 Thyroid cancer
    111151020
   05222 Small cell lung cancer
    111151020
   05223 Non-small cell lung cancer
    111151020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111151020
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:elk03310]
    111151020
Transcription factors [BR:elk03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111151020
Nuclear receptors [BR:elk03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111151020
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 111151020
NCBI-ProteinID: XP_022364431
UniProt: A0A2Y9JUH5
LinkDB
Position
Unknown
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
PPLNALGSPYRVITSAMGPPSGALPAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASGGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtacgggaattattctcacttcatgaagtttcccacaggcttcggcggctcccccggc
cactccggctccacgtccatgagcccatcggcagccttgtccacagggaagccgatggac
agccaccccagctacacggacaccccagtgagtgccccacggactctgagtgcagtgggg
cccccgctcaatgccctgggttctccatatcgagtcatcacgtctgccatgggcccaccc
tccggtgcactgcccgcgcctccaggaatcaatctggtcgccccgcccagctcccagcta
aatgtggtcaacagcgtcagcatttcagaggacatcaaacccttaccagggcttcctggg
attggaaacatgaactacccatcaaccagccccggatctctggtgaaacacatctgtgcc
atctgtggggatagatcctcagggaagcactacggcgtgtacagttgcgaaggctgcaaa
gggtttttcaagagaaccataaggaaagacctcatgtacacgtgtcgcgataataaagac
tgtctcattgacaagcgccagaggaaccggtgtcagtactgccgctaccagaagtgcctg
gtgatgggcatgaagagggaagctgtgcaagaagaaaggcagaggagtcgggagcgtgct
gagagtgaggcagaatgtgccagtggtggccatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgatatgaacatggagaac
tcgacgaatgaccctgtcaccaacatatgccatgctgctgataagcagcttttcaccctt
gttgaatgggccaagcgcatcccccacttctccgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaacgagctgctgattgcctccttctcccaccgctccgtctcg
gtgcaggatggcatcctcctggccactggtttgcacgtccaccggagcagtgcccacagc
gccggagtcggctccatctttgacagagtcctgactgagctggtctccaaaatgaaagac
atgcagatggacaagtcagagttggggtgcctgcgagccatcgtgctgtttaacccagat
gccaaggggctgtccaacccctcagaggtagagactctgcgggagaaggtgtatgccacc
ctcgaggcctacacaaagcagaagtatccggaacaacctggcaggtttgccaagctgctg
ctccgcctcccagccctgcgctccatcggcctgaaatgcctggagcacctgttcttcttc
aagctcatcggggacacgcccatcgacaccttcctcatggagatgttggagaccccgctg
cagatcacctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111152195
Entry
111152195         CDS       T05871                                 

Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03320  PPAR signaling pathway
elk04659  Th17 cell differentiation
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05216  Thyroid cancer
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111152195
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111152195
   03320 PPAR signaling pathway
    111152195
   04919 Thyroid hormone signaling pathway
    111152195
   04928 Parathyroid hormone synthesis, secretion and action
    111152195
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111152195
   05202 Transcriptional misregulation in cancer
    111152195
  09162 Cancer: specific types
   05226 Gastric cancer
    111152195
   05216 Thyroid cancer
    111152195
   05222 Small cell lung cancer
    111152195
   05223 Non-small cell lung cancer
    111152195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111152195
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:elk03310]
    111152195
Transcription factors [BR:elk03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111152195
Nuclear receptors [BR:elk03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111152195
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 111152195
NCBI-ProteinID: XP_022366295
UniProt: A0A2Y9K9Z1
LinkDB
Position
Unknown
AA seq 589 aa
MSWAARPPFLPERHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGAPPSSPPGLPLPPSAASSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQVRGHGSLTASPLSFPCFPCD
PRSLCELPHGPLTFQSSNPGRPVVLVRPLALPEINSTVSLPGGGSGPPEDVKPPVLGVRG
LHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCT
VDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAE
LAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQ
VILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTEL
VSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQG
RFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgtcttgggctgctcgcccgcccttcctccccgagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcctcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcggcagcagccggagagcaacaaaccccg
gagccggagccgggggaggctggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagttcctccccaaatccccttccccagggggcccctccctcttctcctcct
gggctacccctacccccttcagcagcctcctcccttggaggctctggggccccacccccg
cccccgatgccacctcccccactgggctcccctttccctgtcatcagctcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccag
gtgagaggtcatggctcactgactgcctctccactttcatttccttgttttccttgtgac
cccagatccttgtgtgaacttccccatggcccactgaccttccagtcctctaatcctggc
aggcctgtggtccttgtgagaccccttgcccttcctgagattaactcaacagtgtcgctc
cctgggggtgggtctggcccgcctgaagatgtgaagccaccagtcttaggggttcggggc
ctgcactgtccaccccctccaggtggccctggggctggcaaacggctatgtgcaatctgc
ggggaccgaagctcaggcaaacactatggggtttacagctgtgagggctgcaaaggcttc
ttcaagcgcaccatccgtaaggacctgacctactcgtgccgggacaacaaggactgcacc
gtggacaagcgccagcgaaaccgctgtcagtactgccgctatcagaagtgcctggccacc
ggcatgaagagggaggcggtacaggaggagcgtcagcgggggaaggacaaggatggggat
ggggagggggctgggggagcccccgaggagatgcctgtggacaggatcctggaggcagag
cttgctgtggagcagaagagtgaccagggcgttgagggtcctgggggaaccgggggtagc
ggcagcagcccaaatgaccctgtgactaacatctgtcaggcagctgacaaacagctattc
acgcttgttgagtgggcgaagaggatcccacacttttcctccttgcctctggatgaccag
gtcatattgctccgggcaggctggaatgagctcctcattgcttccttctcccaccgatcc
attgatgtccgagatggcatcctcctcgccacaggtcttcatgtgcaccgcaactctgcc
cattctgcaggcgtgggagccatcttcgatcggtccctctccagggtgctgacagagcta
gtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctgagggcaatc
attctgttcaatccagatgccaagggcctctccaatcctagcgaggtggaggttctgcgg
gagaaagtgtacgcatcactggagacctattgcaagcagaagtaccctgagcagcaggga
cggtttgccaagctgctgctacgtcttcctgccctcaggtccatcggccttaagtgtcta
gagcatctgtttttcttcaagctcattggagacacccccattgacaccttcctcatggag
atgcttgaggctccccaccagctggcctga

DBGET integrated database retrieval system