KEGG   Enhydra lutris kenyoni (northern sea otter): 111146071
Entry
111146071         CDS       T05871                                 

Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04060  Cytokine-cytokine receptor interaction
elk04068  FoxO signaling pathway
elk04144  Endocytosis
elk04218  Cellular senescence
elk04350  TGF-beta signaling pathway
elk04371  Apelin signaling pathway
elk04380  Osteoclast differentiation
elk04390  Hippo signaling pathway
elk04520  Adherens junction
elk04659  Th17 cell differentiation
elk04926  Relaxin signaling pathway
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05142  Chagas disease
elk05161  Hepatitis B
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05220  Chronic myeloid leukemia
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111146071
   04350 TGF-beta signaling pathway
    111146071
   04390 Hippo signaling pathway
    111146071
   04371 Apelin signaling pathway
    111146071
   04068 FoxO signaling pathway
    111146071
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111146071
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111146071
  09143 Cell growth and death
   04218 Cellular senescence
    111146071
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111146071
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111146071
  09152 Endocrine system
   04926 Relaxin signaling pathway
    111146071
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111146071
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146071
  09162 Cancer: specific types
   05210 Colorectal cancer
    111146071
   05212 Pancreatic cancer
    111146071
   05225 Hepatocellular carcinoma
    111146071
   05226 Gastric cancer
    111146071
   05220 Chronic myeloid leukemia
    111146071
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111146071
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111146071
   05161 Hepatitis B
    111146071
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111146071
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111146071
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111146071
Protein kinases [BR:elk01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   111146071
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 111146071
NCBI-ProteinID: XP_022357156
UniProt: A0A2Y9J972
LinkDB
Position
Unknown
AA seq 503 aa
MEAAAAAPRPRLLLLVLAAAATLVPGTMALQCFCHLCTKDNFTCVTDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTRSVTTTYCCNQDHCNKIELPTVGPFSGKPSSG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccgcgtccccggctgctcctcctcgtgttggcggcggcg
gcgacgctggttccggggacgatggcattacagtgtttttgccacctttgtacaaaagac
aattttacttgtgtgacagatgggctctgctttgtctctgtcacagagaccaccgacaaa
gttatacacaatagcatgtgtatagctgaaattgacctaattcctcgagacagaccattt
gtatgtgcaccgtcttcaaaaactaggtctgttactacaacctattgctgcaaccaggac
cattgcaataaaatagaactcccaactgttggccctttttcaggaaagccctcatctggc
cttggtcccgttgaactggcagctgtcattgctggaccagtctgcttcgtctgcatctca
ctcatgttgatggtttatatctgccataaccgtactgtgattcaccatcgagtgccaaat
gaagaggatccttccttagatcgcccttttatttcggagggcactacattaaaagattta
atttatgatatgacgacatcaggttctggatcaggtttaccattgcttgttcagagaaca
attgcaagaactattgtgttacaagaaagtattggcaaaggtcgatttggagaagtttgg
cggggaaagtggagaggagaagaagttgctgttaaaatattctcctctagagaagagcgc
tcatggttccgtgaggcagagatttatcagaccgtaatgttacgtcatgaaaacatcctg
ggatttatagcagcagacaataaagacaatggtacatggactcagctctggttggtgtca
gattatcatgagcatggatccctttttgattatttgaacagatatacagttactgtggaa
ggaatgataaaacttgctttgtccacagcaagcggacttgcccatctccacatggagatt
gttggtacccaagggaaaccagccattgctcatagagatttgaaatccaaaaatatcttg
gtaaagaagaatggaacttgctgtattgcagacttaggactggcagtgagacacgattca
gccacagatacaatagatattgctccaaatcacagagtgggaacaaaaaggtacatggcc
cctgaagttctagatgattccataaatatgaaacactttgaatccttcaaacgtgctgac
atctatgcaatgggcttagtattctgggaaatagctcgacgatgttccattggtggaatt
catgaagattaccagctgccttattatgatctcgtaccttctgatccatcagttgaagaa
atgagaaaagttgtttgtgaacagaagttaaggccaaatattccaaacagatggcagagt
tgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgccaatggagca
gcaaggcttacggctttgcgtattaagaaaacactgtcacaactcagtcaacaggaaggc
atcaaaatgtag

DBGET integrated database retrieval system