KEGG   Enhydra lutris kenyoni (northern sea otter): 111146098
Entry
111146098         CDS       T05871                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12 isoform X1
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04270  Vascular smooth muscle contraction
elk04730  Long-term depression
elk04810  Regulation of actin cytoskeleton
elk04928  Parathyroid hormone synthesis, secretion and action
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111146098
   04072 Phospholipase D signaling pathway
    111146098
   04071 Sphingolipid signaling pathway
    111146098
   04022 cGMP-PKG signaling pathway
    111146098
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111146098
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    111146098
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111146098
  09156 Nervous system
   04730 Long-term depression
    111146098
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146098
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111146098
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111146098
   04031 GTP-binding proteins [BR:elk04031]
    111146098
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   111146098
GTP-binding proteins [BR:elk04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    111146098
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU
Other DBs
NCBI-GeneID: 111146098
NCBI-ProteinID: XP_022357188
UniProt: A0A2Y9J889
LinkDB
Position
Unknown
AA seq 383 aa
MSGVVRTLSRCLLPAEAGGARERRAGGGGGARDAEREARRRSRDIDAGLARERRAVRRLV
KILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIP
WQYSENEKHGMFLLAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGES
VKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKW
FQCFDGITSILFMVSSSEFDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKM
DLLVEKVKTVSIKKHFPDFKGDPHRLEDVQRFLVQGFDRKRRNRSRPLFHHFTTAIDTEN
IRFVFHAVKDTILQENLKDIMLQ
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtccggcgtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcggcggcggcggggcccgcgacgcggagcgcgaggcgcggcgg
cgcagccgggacatcgacgcggggctggcccgcgagcggcgcgccgtgcggcgcctcgtc
aagatcctgctgctgggcgcgggcgagagcggcaagtccaccttcctcaagcagatgcgc
atcatccacggccgcgagttcgaccagaaggcgctgctcgagttccgcgacaccatcttc
gacaacatcctcaagggctcacgcgttcttgtcgatgcacgagacaagcttggcattcca
tggcagtattcggagaatgagaagcacggcatgttcctcctggcctttgagaacaaagcg
gggctgcccgtggagcccgccaccttccagctgtacgtcccggcgctcagcgctctctgg
agggactccggcatcagggaggctttcagccggaggagcgagttccagctgggtgaatcg
gtgaagtactttctggataacttggaccggatcggccagctgaattactttcctagcaag
caggacattctgctggcacggaaagccaccaagggcattgtggaacatgacttcgttatt
aaaaaaatcccttttaagatggtggacgtgggcggccagcggtcccagcgccagaagtgg
ttccagtgcttcgacgggatcacatcgatcctgttcatggtgtcctccagcgagttcgac
caggtgctcatggaggacaggcgcaccaaccggctagtggagtccatgaacatcttcgag
accatagtcaacaacaagctgttcttcaacgtctccatcatcctcttcctcaataagatg
gacctcctggtggagaaggtcaagaccgtgagcatcaagaagcacttcccagacttcaag
ggcgacccgcacaggctggaggacgtgcagcgcttcctggtgcagggcttcgaccgcaag
agacggaaccgcagcaggccgctcttccaccacttcaccaccgccatagacacggagaac
atccgcttcgtgttccacgctgtgaaggacaccatcctgcaggagaacctgaaggacatc
atgctgcagtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158131
Entry
111158131         CDS       T05871                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13 isoform X1
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04022  cGMP-PKG signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04611  Platelet activation
elk04730  Long-term depression
elk04810  Regulation of actin cytoskeleton
elk04928  Parathyroid hormone synthesis, secretion and action
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111158131
   04072 Phospholipase D signaling pathway
    111158131
   04071 Sphingolipid signaling pathway
    111158131
   04022 cGMP-PKG signaling pathway
    111158131
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111158131
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111158131
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    111158131
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111158131
  09156 Nervous system
   04730 Long-term depression
    111158131
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158131
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111158131
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111158131
   04031 GTP-binding proteins [BR:elk04031]
    111158131
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111158131
  Exosomal proteins of colorectal cancer cells
   111158131
GTP-binding proteins [BR:elk04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    111158131
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 111158131
NCBI-ProteinID: XP_022375712
UniProt: A0A2Y9KP12
LinkDB
Position
Unknown
AA seq 377 aa
MADFLPSRSVLSVCFPGCVLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQVNGD
KMMAFDTRSPMASQGMVETQVFLQYLPVIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEADYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcgtgctg
acgagcggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtcccgg
gagaagacctacgtgaagcggctcgtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgattaaaggtatgagggtgctggta
gatgctcgagagaagcttcatattccgtggggagataactcaaaccaagtcaacggagac
aagatgatggcgtttgacacccgctctcccatggcgtcccagggaatggtggaaactcaa
gtttttttgcaatacctccctgttataagagcattatgggcagatagtggtatacagaat
gcctatgaccggcgtcgagagtttcaactgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagaagcagattacattccctcacaacaagatatcctgcttgccaga
agacccaccaaaggcattcatgagtacgactttgaaattaaaaatgttcctttcaaaatg
gttgatgtgggtggtcaaagatcagagagaaaacgatggtttgagtgcttcgacagcgtc
acgtcaatacttttccttgtttcctcaagtgagttcgaccaggtgctgatggaagaccga
ctgaccaatcgcctcacagaatctctgaacatttttgaaacaatcgtcaacaaccgggtt
ttcagcaatgtctccataattctcttcttaaacaagacagatttgcttgaggagaaagtg
caaattgtgagcatcaaagactacttcttagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggagtgtttccggaacaaacgccgggaccagcagcagaag
cctttgtaccaccacttcaccaccgctatcaacacggagaacatccgcctcgttttccgc
gacgtgaaggataccattcttcacgacaacctcaagcagctcatgctacagtga

DBGET integrated database retrieval system