KEGG   Enhydra lutris kenyoni (northern sea otter): 111146104
Entry
111146104         CDS       T05871                                 

Definition
(RefSeq) golgin subfamily A member 2 isoform X1
  KO
K20358  golgin subfamily A member 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Brite
KEGG Orthology (KO) [BR:elk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111146104
Membrane trafficking [BR:elk04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    111146104
SSDB
Motif
Pfam: GOLGA2L5 GM130_C Intein_splicing
Other DBs
NCBI-GeneID: 111146104
NCBI-ProteinID: XP_022357202
UniProt: A0A2Y9J8A9
LinkDB
Position
Unknown
AA seq 1032 aa
MWPPLPSPLPGMSEETRQSKLAAAKKKLREYQQKNSPGTPAGVKKKRKIKNGSCSETTAS
HSCHSPEDIQDILKVLVSDLNRSNGVALPPLDKWQAPKDRATPATPTIDDTVAPDGVPSP
CASPLRVTSMASVQSHDAENGPFLTDENECLSSTESLRQLSQQLNGLVSESSSYVNGEGL
SPANMKDLESRYQELSLALDSSNLTNKQLSNKIEELKQQNQESLDQLEKEKKEFEQKLAK
EQGSLREQLQVHIQTIGILVSEKTELQTALAHTQQAARQKAGESEDLASRLQSSRQRIGE
LERTLSAVSTQQKQVERHNKDLTKERDALKLELYKNNKNTEDLKEQNSELEEKLRVLVNE
KAGMKLKMEELQKKLEMSELLLQQFSSESKPHDSSQELQQALEERARLEARVGQLSDLLK
QLQFERDCYVENLKEDSAYWQDKMRQMSEQMHKLRDEKEHSVCQVQELEASVAELKKQLV
VPPAPEPPAGPSEEEQRLQMEAEQLQKELEILAGQLQAQVKDNEGLSRLNQEQEQRLLEL
ERAAECWGDQAEERKRILETMQSDRTTISRALSQNRELKEQLAELQDGFVKLSNENMEVT
TALQTEQHIKNELAKRLGQLQEKLGELKETVELKSREAESLQQQRDQYVSHLQQYVAAYQ
QHVAAYQQLASDKELLQRQVLVQTQLMDRLQSEDIEVKVAAEKARQELEETQGRLEAATQ
QNQQLQAQLSLMAMPGEGDGLDGEEKDEAAARPKLSMPEGLDSREAMVAYFNSALAGAEE
EQARLRGQLKQQKLRCRRLAHLVAPGQEQEAGDKAPGSGGDSVPVETHQALQEAMDKLQG
RFTALIQEKVDLKERVDELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKEEYISR
LAQDKEEMKVKLLELQDLVLRLVDERDKWQGKAAAHNPAGEPAAAPPARELGDANGQGDI
QEVNLANEESVAPPQGEALPGRSAPENPTAQQIIQLLREMQNTQQRPGLGDNPCIPFFYR
ADDNDEVKIMVI
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgtggcccccccttccctccccccttcccgggatgtcggaagaaacccgacagagcaaa
ttggcagctgccaagaaaaagttgagggagtatcagcagaagaatagtcctggtactcct
gcaggagtaaagaaaaaacggaagatcaaaaatgggagttgctcagaaacaacagcttct
catagttgtcactcccctgaggatattcaggacatcctgaaggtgctggtgtccgacctt
aaccgctccaatggggtagcactccccccattggacaagtggcaggcgcccaaagaccgc
gccactcctgccacaccaactattgatgacaccgtggcacctgatggtgtcccttcgcct
tgtgctagtccccttcgtgttactagcatggcgtcagttcagagtcacgatgcagaaaat
ggccctttccttacggatgaaaacgaatgtctgtcatctaccgagagcctgcgacaactt
tctcagcagctcaatggtcttgtgtctgagtcttcatcctacgtcaatggagagggcctg
tcgcctgctaatatgaaggatctggagagccggtaccaagagctatcactagccctggac
tccagcaatctaacaaacaaacaactcagtaacaagatagaagaattgaagcagcaaaac
caggaatctttggaccaactggaaaaagagaagaaggagtttgagcagaagcttgccaag
gagcagggctccctaagggagcaactgcaggttcatatccagaccataggaattctggtg
tctgagaagactgaattacagacagccttggcacatacccagcaggcggccaggcaaaaa
gcaggagaatctgaagatcttgctagtcgtctgcagtcttcccgccagcgcatcggagaa
ctggagcgcaccctgtctgccgtctccacgcagcagaaacaggtggagaggcacaacaag
gacctaaccaaagagcgagatgccctgaagctggagttatacaagaacaacaaaaacacc
gaggacctgaaggagcagaactcggaactggaagagaagcttcgggtgttggtgaacgag
aaggcgggcatgaagctcaagatggaggagctgcagaagaagctggagatgtcagagctt
ctgctgcagcagttttctagtgaatcgaaaccccacgatagcagccaggagttacagcag
gccctagaggagcgggcacgcctggaggcccgtgtggggcagctgagcgatttactgaag
caactgcaatttgaaagagactgttatgtggagaatctgaaggaggacagtgcttactgg
caagacaaaatgcggcaaatgtccgaacagatgcacaaactgagggacgagaaggagcat
agtgtgtgtcaggtgcaggaactggaggccagcgtggccgaactgaagaagcagctagtg
gtgcctccagccccagagcccccagctgggccctcggaggaggagcagcggctgcaaatg
gaggcggagcaactacagaaggaactggagatcctggcggggcagctgcaggcccaggtg
aaggacaacgaaggtctgagtcgcctgaaccaggagcaggagcagcggctgctggagctg
gagcgcgccgccgagtgctggggggaccaggctgaggagcgcaagaggatcctggagacc
atgcagagcgaccgtaccaccatcagccgcgcgctgtcccagaaccgcgagctcaaggag
cagctggctgagctgcaggacggcttcgtcaagctgtccaatgagaacatggaggtcacc
actgcgctgcagacagaacagcacatcaagaatgagctggccaagagactgggccagctg
caggagaagctgggggagctgaaggagacagtggagctgaagagccgggaggccgagagc
ctgcagcagcagcgcgaccagtacgtgagccacctgcagcagtatgtggcggcctatcag
cagcacgtggctgcctaccagcaactggcttcggacaaggagctcctgcagaggcaggtc
ctggtgcagacccagctcatggaccggctgcagagcgaggatattgaggtcaaggtggcg
gccgagaaggcccgccaagagttagaggagacccagggacgcctggaagctgccacccag
cagaaccagcagctccaggcccagctgagcctcatggctatgcctggagaaggagacgga
ctggacggtgaggagaaggacgaggcggctgcccgtccgaagctgagcatgccagagggc
ctggatagccgagaggccatggtggcatattttaactcggccttagccggtgctgaggaa
gagcaggcccggctgcgtgggcagctgaagcaacaaaagctgcgttgtcggcgcctggct
cacctggtggcccccggccaagagcaggaggcaggtgacaaggcccctgggagcgggggc
gacagtgtgcctgtggagacccaccaggccctccaggaggcaatggacaagctgcagggc
cgcttcacggccctcatacaggagaaggtggatctgaaggagcgggtggatgagctggag
catcggtgcatccagctttctggagagacggacactattggagagtatattgccctctac
cagagtcagagggccgtgctcaaggagcggcaccgggagaaggaggagtacattagccgg
ctggctcaggacaaggaggaaatgaaggtgaagctgctggagctgcaggacttggtgctt
cgcctagtcgacgagcgtgacaaatggcagggcaaggccgctgcccacaaccctgctggg
gagcctgctgcggcacccccagcccgagagcttggcgatgccaatggccaaggcgatatt
caagaggtgaacctggccaacgaggagagtgtggcacctccccagggagaggccctgccg
ggccgcagtgcccccgagaaccctactgcacagcagatcatacagctgctgcgagagatg
cagaacacccagcagcgcccaggcttgggcgacaacccctgcatccctttcttctaccgg
gctgatgacaacgacgaggtgaagatcatggtgatctaa

DBGET integrated database retrieval system