KEGG   Enhydra lutris kenyoni (northern sea otter): 111146240Help
Entry
111146240         CDS       T05871                                 

Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00512  Mucin type O-glycan biosynthesis
elk00514  Other types of O-glycan biosynthesis
elk01100  Metabolic pathways
Module
elk_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    111146240
   00514 Other types of O-glycan biosynthesis
    111146240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:elk01003]
    111146240
Enzymes [BR:elk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     111146240
Glycosyltransferases [BR:elk01003]
 O-Glycan biosynthesis
  Mucin-type
   111146240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 111146240
NCBI-ProteinID: XP_022357412
UniProt: A0A2Y9J8X1
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MASLRRVKVLLGLNLIAVAGFVLFLAKCRPISVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYAKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENAGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLSKRWSFAQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgctggggttgaacctgatcgcggtggccggc
ttcgtgctcttcctggccaagtgccggcccatctcggtgcgcagcggagacgccttccac
gagattcggccgcgcgccgaggcggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctctctctgctcgaggacatcgtatatcggcaactgaacggc
ttatccaaatcccttgggctcattgaaggctatggcgggcggggcaaggggggccttcct
gctaccctttcccccgctgaagaagagaaagccaagggacctcacgagaagtatggctac
aattcctacctcagtgagaaaatttcactggatcgttccattccggattatcgtcctacc
aagtgcaaggagctgaagtacgccaaggagctgccacagatctccatcatcttcatcttc
gtgaacgaggcgctgtcagtgatcctgcggtccgtccacagtgctgtcaaccacacgccc
acacacctgctcaaggagatcatcctggtggatgacaacagcgacgaagaggagctgaag
gcccccctggaggagtacgtccacaagcgctaccccgggctggtgaaggtggtccgcaac
cagaagagagagggcctgatccgagctcgcatcgagggctggaaggtggccacgggccag
gtcactggcttctttgatgcccatgtggagttcaccgctggctgggccgagccagttctg
tcccgaatccaggagaaccggaagcgagtgatcctcccgtccatcgacaacatcaaacag
gacacgtttgaggtgcagcggtacgagaactcggcccacggctacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgccggggacccgtctctccccatc
aggacgcccgccatgattggctgctcctttgtggtcaacagaaagttcttcggggaaatc
ggtctgctggaccctggcatggatgtgtacgggggagaaaatatcgaactcggaatcaag
gtgtggctctgcgggggcagcatggaggtcctgccttgctcacgagtggcccacatcgag
cggaagaagaaaccttacaacagcaacattggtttctacaccaagaggaacgccctccgg
gttgctgaggtctggatggacgactacaagtctcatgtgtacatagcgtggaacctgcca
ctggagaatgcgggaattgacataggcgatgtgtccgagagaagagccttgaggaagagt
ttaaagtgcaagaatttccagtggtacctggaccacgtgtacccagaaatgagaagatac
aataacaccgttgcatacggggagcttcgaaacaacaaggcgaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatactgtacccgtgccacggctggggaccccag
cttgcccgctacaccaaggagggcttcctgcacttgggtgccctggggaccaccacgctc
ctccctgacacccgctgcctggtggacaactccaagagtcgtctgccccagctcctcgac
tgcgacaaagtcaagagcagcctgtccaagcgctggagctttgcccagaatggagccatc
atgaataagggcacagggcgttgtctagaggtggagaaccggggcctggctggcattgac
ctcatcctccgcagctgcacgggacagaggtggacaattaagaactcgatcaagtag

DBGET integrated database retrieval system