KEGG   Enhydra lutris kenyoni (northern sea otter): 111146581
Entry
111146581         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: brain-specific angiogenesis inhibitor 1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111146581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111146581
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111146581
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:elk04030]
    111146581
Peptidases and inhibitors [BR:elk01002]
 Mixed peptidases
  Family P2
   111146581
Membrane trafficking [BR:elk04131]
 Endocytosis
  Phagocytosis
   Others
    111146581
G protein-coupled receptors [BR:elk04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   111146581
SSDB
Motif
Pfam: AGRB_N 7tm_2 TSP_1 GAIN TSP1_spondin TSP1_ADAMTS GPS HRM TSP1_CCN
Other DBs
NCBI-GeneID: 111146581
NCBI-ProteinID: XP_022357902
UniProt: A0A2Y9JA69
LinkDB
Position
Unknown
AA seq 1578 aa
MRGQAAAPGPLCRTLCPRPPLLLLLLLLLLLLGRRARAAAGADAGPGAEPCATLVQGKFF
GYFSAAAVFPSNASRCSWTLRNPDPRRYTLYMKVAKPPAPCGGPGRVRTYQFDSFLESTR
TYLGVESFDDVLQLCDPSAPLAFLQASKQFLQMLRQQPPPDPGPRLLGASPGPSDDFSVE
YLVVGNRHPSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACVGGDGGAPAPRGDVCLR
DGVAGGPENCLTSLTQDRGRDGAAGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGAEGG
GCEGVLEEGRLCNRKACGPAGRASSRSQSLRSTDARRREELGDELQRFGFPSPQTGDPAA
EEWSPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSP
WSLCSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRALDGNWNEWSSWS
ACSASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQTWASWGGCSVT
CGGGTQRRERVCSGPFFGGAACQGPQDEQRQCGAQRCPEPHEICDEDNFGTVVWKETPAG
EVAAVRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGL
PGEGVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDAQNFVQIIS
NLLAEENREKWEEAQLMGPNAKELFRLVEDFVGVIGFRMKDLRDAYQVTDNLVLSIHKLP
ASGATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLAEADDSSVFVVGTALYRNLGS
FLALQRNTTVLNSKVISVTVKPPPRSLLTPLEIEFAHLYNGTTNQTCILWDESDVPSSPA
PPQLGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADANMEKVIVPSVTLIVGCGV
SSLTLLMLIIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAF
LHFFFLSSFCWVLTEAWQSYMAVTGRLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGY
STMNYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLW
SSCVVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKC
RVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPS
LPEEEKLKVAHAKVPPTNFNSLPANVSKLHLHGSPRCPGGPLPDFPNHSLTLKKDRAPKS
SFAGDGDIFKKLDSELSRAQEKALDTSYVILPTATATLRPKPPEEAKHSIHLDQMPQTRL
IHLSMAPDASLPARSPPTRQPPGAGPPEAPPAQPPPPPPPPPPPPTLEPAPPSLGEPGEP
AAHPGPSSGAGTRNENVSTLSVSSLERRKSRYAELDFEKIMHTRKRHQDLFQDLNRKLQH
AEKDKEALGPDSKPEKQQTPNKRPWESLRKAHGTPAWVKKELEPLPPSPLELRSVEWEKS
GATIPLVGQDIIDLQTEV
NT seq 4737 nt   +upstreamnt  +downstreamnt
atgaggggccaggccgccgccccggggcccctctgccggaccctctgcccgcggccgccg
ctgctgctgctgctgctgctgctgctgctgctgctggggcgtcgggcgcgggcggctgca
ggggccgacgcggggcccggggccgagccgtgcgccacgctggtgcagggcaagttcttc
ggctacttctcggcggccgccgtgttcccctccaacgcctcccgctgctcctggaccctg
cgtaaccccgacccccgccgctacacactctacatgaaggtggccaagccgcccgcaccc
tgtggcggccccggccgcgtccgcacctaccagttcgactccttcctggagtccacgcgc
acctacctgggcgtggagagcttcgacgacgtgctgcagctctgcgacccctccgcgccc
ctggccttcctgcaggccagcaagcagttcctgcaaatgctgcgccagcagccgccccca
gaccccggcccccggctgctgggggcgtccccgggccccagcgacgacttctccgtggag
tacctggtcgtgggcaaccgccacccgagccgggccgcctgccagatgctgtgtcgctgg
ctggacgcctgtctggccggcagccgcagctcacacccctgtgggatcatgcagaccccc
tgtgcctgcgtgggcggggacggcggcgccccggccccccgcggggacgtctgcctgagg
gacggtgtggccggcggccctgagaactgcctcaccagcctgacccaggatcggggcaga
gacggtgctgcaggtggctggaagctgtggtccctgtggggcgagtgcacgcgggactgc
gggggaggcctgcagacgcggacccgcacctgcctgccggcccccggcgccgagggcggc
ggctgcgagggggtgctggaggagggccgcctctgcaaccgcaaggcctgcggcccggcc
gggcgcgccagctcccgaagccagtccctgcggtccacagacgcccggcggcgtgaggag
ctgggggacgagctacagcgtttcggcttcccatccccgcaaacaggtgaccccgcagcc
gaggagtggtccccgtggagcgtgtgctccagcacctgcggcgaaggctggcagacccgc
acgcgcttctgcgtgtcctcctcctacagcacgcagtgcagcgggcctctgcgggagcag
cggctgtgcaacaattccgcggtgtgtccagtgcacggcgcctgggacgagtggtcgcct
tggagcctctgctccagcacctgtggccgtggcttccgagaccgcacgcgcacctgcagg
cccccccagtttggaggcaacccctgtgagggccctgagaagcaaactaagttttgcaac
attgccctgtgtcctggtagggcactggatggaaactggaacgagtggtcaagctggagc
gcgtgctccgccagctgctcccagggccggcagcagcgcacacgggagtgcaacgggccg
tcctacgggggcgctgaatgccagggccactgggtggagactcgggactgcttcctccag
cagtgcccagtggatggcaagtggcagacctgggcgtcatggggcggctgcagtgtcacg
tgcgggggcggcacccagcgacgagaacgagtctgctccggtccgttttttgggggagct
gcctgccagggccctcaggatgagcagcggcagtgcggtgcccagcggtgtcccgagccc
catgagatctgtgacgaggacaactttggcacggtggtctggaaggagactccagcagga
gaggtggctgcagtccggtgtccccgcaatgccacaggcctcatcctgcgacgctgcgag
ctggacgaggagggcatcgcctactgggagccccccacctacatccgttgtgtctccatc
gactaccggaacatccagatgatgactcgggagcacctggcgaaggcgcagcgtgggctg
cctggggagggggtgtccgaggtgatccagacgcttgtggagatctcccaggacgggacc
agctacagtggggaccttctctccaccatcgacgtcctgaggaacatgacggagatcttc
cggagggcgtattacagtcctacccctggggacgcgcagaactttgtgcagatcatcagc
aacctgctggcagaagagaaccgggagaagtgggaggaggcccagctgatgggtcccaat
gccaaggagctcttccggctggtggaggacttcgtaggcgtcatcggcttccgcatgaag
gacctgcgggacgcgtaccaggtcacagacaacctggtcctcagcatccataagctcccg
gccagcggggccacagacatcagcttccccatgaagggctggcgggccacgggcgactgg
gccaaggtgccggaggacagggtcacggtgtccaagagcgtcttctccacggggttggca
gaggctgatgactcgtctgtgttcgtggtgggcaccgcgctctacagaaacctgggcagc
ttcctggccctacagaggaacacgaccgtgctgaactccaaggtcatctctgtgacagtg
aagcccccgccacgctccctgctcacgcccttggagatagagttcgcccacctgtataac
ggcaccaccaaccagacctgcatcctgtgggacgagtcggacgtgccctcctcccccgcc
cccccgcagctcgggccctggtcgtggcgcggctgccgcacggtgcccctcgacgccctc
cggacgcgctgcctctgtgaccggctctccaccttcgccatcttagcccagctcagcgcc
gacgcgaacatggagaaggtgatcgtgccgtcggtgacgctcatcgtgggctgtggcgtg
tcatccctcaccctgctcatgctgattatcatctacgtgtctgtgtggaggtacatccgc
tcggagcggtcggtcatcctcatcaacttctgcttgtccatcatctcctccaacgccctc
atcctcatcgggcagacccagacccgcaataaggtggtgtgcacgctggtggccgccttc
ctgcactttttcttcctgtcgtccttctgctgggtgctcaccgaggcctggcagtcctac
atggccgtgacgggccgcctcaggaaccgcctcatccggaaacgcttcctctgcctgggc
tgggggctccctgcactggtcgtggccatttctgtgggattcaccaaggccaaagggtac
agcaccatgaactactgctggctgtccctggaggggggactgttgtacgccttcgtggga
ccggccgccgccgtcgtactggtgaacatggttatcgggatcctggtgttcaacaagctc
gtgtccaaggacggcatcacggacaagaagctgaaggagcgggcaggggcctcgctgtgg
agctcctgcgtggtgctgccgctgctggcgctgacctggatgtcggccgtgctcgctgtc
accgaccgccgctccgccctcttccagatcctgttcgccgtcttcgactcgctggagggt
tttgtcatcgtgatggtccactgcatcttgcgcagagaggtccaggacgccgtgaagtgc
cgcgtggtggaccggcaggaggagggcaacggggactcggggggctccttccagaacggc
cacgcccagctcatgactgacttcgagaaggacgtggatctggcctgtagatcagtgctg
aacaaggacatcgcggcctgccggacggccacgatcaccggcacgctcaagcggccatcg
ctgcccgaggaggagaagctgaaggtagcccacgccaaggtgccccccaccaacttcaac
agcctgcccgccaacgtgtccaagctgcacctgcacggctcaccccgctgcccgggcggc
cccctgcccgacttccccaaccactccctgaccctcaagaaggacagggcgcccaagtcc
tcctttgccggcgacggggacatcttcaagaagctggactcggagctgagccgggcccag
gagaaggccctggacaccagctacgtcatcctgcccacggccacggccacgctgcggccc
aagccgccggaggaagccaagcacagcatccacctagaccagatgccccagacccgcctc
atccacctcagcatggcccccgacgccagcctcccggcccgcagcccacccacccgccag
cctccgggcgccgggcccccggaggccccccccgcccagcccccgccgccgccgcccccc
ccaccccccccccccaccctggagcccgcaccccccagcctgggggagcctggggagccc
gcggcccacccggggcctagctcgggggccgggaccaggaacgagaacgtctccaccttg
tccgtgagctccctggagcggcggaaatcacggtacgcggaactggatttcgagaaaatc
atgcacacgcggaaacggcaccaggacctgttccaggacctaaaccgaaagctgcagcac
gccgagaaggacaaggaggccctgggcccggacagcaagccggagaagcagcagacgccc
aacaagcggccctgggagagccttcggaaagcccacgggacgcccgcgtgggtgaagaag
gagctggagccactgccaccgtccccgctggagctgcggagcgtggagtgggagaagtcg
ggcgccacaatcccgctggtgggccaggacatcatcgacctccagactgaggtctga

DBGET integrated database retrieval system