KEGG   Enhydra lutris kenyoni (northern sea otter): 111146667
Entry
111146667         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111146667
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111146667
   04371 Apelin signaling pathway
    111146667
   04020 Calcium signaling pathway
    111146667
   04072 Phospholipase D signaling pathway
    111146667
   04024 cAMP signaling pathway
    111146667
   04022 cGMP-PKG signaling pathway
    111146667
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111146667
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111146667
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111146667
   04062 Chemokine signaling pathway
    111146667
  09152 Endocrine system
   04911 Insulin secretion
    111146667
   04923 Regulation of lipolysis in adipocytes
    111146667
   04912 GnRH signaling pathway
    111146667
   04913 Ovarian steroidogenesis
    111146667
   04915 Estrogen signaling pathway
    111146667
   04914 Progesterone-mediated oocyte maturation
    111146667
   04921 Oxytocin signaling pathway
    111146667
   04926 Relaxin signaling pathway
    111146667
   04935 Growth hormone synthesis, secretion and action
    111146667
   04918 Thyroid hormone synthesis
    111146667
   04928 Parathyroid hormone synthesis, secretion and action
    111146667
   04916 Melanogenesis
    111146667
   04925 Aldosterone synthesis and secretion
    111146667
   04927 Cortisol synthesis and secretion
    111146667
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111146667
   04270 Vascular smooth muscle contraction
    111146667
  09154 Digestive system
   04970 Salivary secretion
    111146667
   04971 Gastric acid secretion
    111146667
   04972 Pancreatic secretion
    111146667
   04976 Bile secretion
    111146667
  09156 Nervous system
   04724 Glutamatergic synapse
    111146667
   04727 GABAergic synapse
    111146667
   04725 Cholinergic synapse
    111146667
   04720 Long-term potentiation
    111146667
   04723 Retrograde endocannabinoid signaling
    111146667
  09157 Sensory system
   04742 Taste transduction
    111146667
   04750 Inflammatory mediator regulation of TRP channels
    111146667
  09149 Aging
   04211 Longevity regulating pathway
    111146667
   04213 Longevity regulating pathway - multiple species
    111146667
  09159 Environmental adaptation
   04713 Circadian entrainment
    111146667
   04714 Thermogenesis
    111146667
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146667
  09165 Substance dependence
   05032 Morphine addiction
    111146667
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111146667
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111146667
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111146667
   05163 Human cytomegalovirus infection
    111146667
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111146667
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111146667
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 111146667
NCBI-ProteinID: XP_022358021
UniProt: A0A2Y9JBQ9
LinkDB
Position
Unknown
AA seq 1252 aa
MELSDVRCLSGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGSGGS
SGSRGSGKASDPAGGGPNHHAAQLSGESALPLYSLGPGERAHSTGGTKVFPERSGSGSGS
GSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRR
KSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSH
TYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGT
SLLQVALQAAIPRLAVISVNQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEA
RLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFAD
VKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHA
HCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANK
LESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPE
DIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALH
VQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCA
FIVLLFITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWIN
ETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFT
GVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTKE
VSLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHV
ARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFD
ELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINK
HSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLI
LKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL
VQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLTPSGPEPGAQAEGTDKSDLP
NT seq 3759 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgcctaagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcgggagcggctctcggccgcagcggctgctgtggcagacg
gcggtgaggcatatcaccgagcagcgcttcattcacgggcaccggggtagcggcggcagc
agcgggagtagaggctccggcaaagcctcggaccctgcaggcggcggccccaaccatcac
gcggcgcagctgtccggcgaatcggcgctgcccctctactcgctgggccccggggagaga
gctcacagtaccggaggcaccaaagtcttcccggaacgcagcgggagcggcagcggcagc
gggagcgggggcgggggtgatctgggcttcctgcacctcgactgtgccccgagcaactcg
gatttcttcctcaacgggggctacagctaccgaggggtcattttccccactctgcgcaac
tccttcaagtcccgggatctggagcgcctctaccagcgctatttcctgggccagaggcgc
aaatccgaggtggtaatgaatgtgctggacgtgctgaccaaactcaccttgttggtcctc
cacctgagcctggcttcggccccgatggaccctctcaagggcatcctcctgggcttcttc
actggcatcgaggtggtgatctgcgccctggtggtggtcaggaaggacaccacctcgcac
acgtacctgcagtacagtggcgtggtcacttgggtggccatgaccacccagatcttggca
gcaggccttggctacgggcttctgggtgatggcatcggttacgttctcttcacactgttc
gccacctacagcatgctgccgctgccgctcacctgggccatcctggccggcctaggcacc
tctctgctgcaggtggccctgcaggcggccattcctcgactggctgtcatttccgtcaac
caggttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatcagt
tacctgtcagaccgggcccagcgccaagccttcctggagacgcggaggtgtgtggaggcc
aggctacgcctggagacggaaaaccaaagacaggaacggcttgtgctgtctgtgctcccc
cgctttgtcgtcctggaaatgatcaatgacatgaccaatgttgaagatgagcacttgcag
caccagttccatcggatctacatccaccgttatgagaacgtcagtattcttttcgcagat
gttaaaggatttaccaacctctccacgaccttgtctgcccaggagctggtccggatgctc
aacgagctctttgccagatttgatcgactggctcatgagcatcactgccttcgcattaaa
atcctgggggactgttactactgtgtttcagggcttcctgagccccgccaggaccacgcc
cactgctgcgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtgaggtcaagg
acgaagcatgatgtggacatgaggattggaatccactcaggatcagttctatgtggagtg
ctgggcctacggaagtggcagtttgatgtctggtcctgggatgtggacatcgcgaacaaa
cttgaatctggaggaatccctgggaggattcacatttccaaagccacgctggactgcctc
aatggtgactataatgtggaagagggtcatggtaaagagagaaacgaattcttgaggaag
cataatatagagacctacttgattaagcagcctgaggagagtctgctgtcattgcccgaa
gacattgtcaaggaatcggtgagctcctcagacaggagaaacagtggggcgacattcaca
gaaggatcctggagccccgaactgccctttgataacatagtggggaaacagaacactctg
gctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttgcat
gtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagt
ggcgataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagc
ctggagcacaagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgtgca
tttatcgttcttctatttatcacggcgatacaaagtttgcttccttcttcaagggtgatg
ccaatggccatccagttttccatcctgattatgctgcactcggctctcgtcctcatcacc
acggcagaggattataagtgtttgcccctcatcctccggaaaacttgctgttggattaat
gagacctatttggcccggaacgtcatcatctttgcatccatcttgattaacttcctgggt
gccatcttgaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgact
ttcaattcctcagctgtgtttacagatatctgctcctacccagagtacttcgtcttcacc
ggggtgcttgccatggtgacctgtgcagttttcctccgcctgaactctgtcctgaagctg
gctgtgttgctgattatgatcgccatctacgctctgctgactgagaccatctatgcaggc
ctctttctgcgctacgacaacctgaaccacagtggagaagatttcctggggaccaaggag
gtgtcactgctgctgatggccatgttcctccttgctgtgttctaccatggacagcagctg
gagtacacagcccgccttgacttcctttggcgagtacaggccaaagaggagatcaatgag
atgaaggagctaagggaacacaacgagaacatgctccggaacattctgcccagccacgtg
gcccgccacttcctggagaaagaccgagacaatgaggagctgtattctcaatcctatgat
gccgtcggggtgatgtttgcctccatcccggggtttgcagacttttactctcaaactgaa
atgaataaccaaggagtggagtgcctgcgcctgctgaatgaaatcattgctgacttcgat
gagctcctcggcgaagaccggttccaagacattgaaaagattaagaccattggcagcacc
tacatggccgtgtcaggcctgtctcccgagaaacagcaatgtgaagacaagtggggacat
ttgtgtgccctagctgacttctccctcgccctgactgagagcatacaggagatcaacaaa
cattccttcaacaatttcgaactccggattggcattagccatggctccgtggtagctggc
gttatcggcgctaagaaaccacagtatgacatttggggcaaaaccgtgaacctggcaagt
cgaatggacagcacaggtgtcagcggcaggatccaagtccccgaggagacctatctcatc
ctgaaggaccagggctttgcctttgactaccgaggggagatctatgtgaagggcatcagt
gaacaggaaggaaaaatcaaaacgtactttctgctgggaagagtccaacccaatccattc
atcttgcccccgagaagactgcccgggcagtactccttggccgcagtcgtcctgggcctt
gtccagtctctcaaccggcaaaggcagaagcagctgctcaatgagaacaacaacacgggg
attatcaagggtcattacaaccggcggactttgttgacacccagcgggccagagcctgga
gcccaagccgaaggcactgacaagtctgatttgccataa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111153427
Entry
111153427         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04922  Glucagon signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111153427
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111153427
   04371 Apelin signaling pathway
    111153427
   04020 Calcium signaling pathway
    111153427
   04072 Phospholipase D signaling pathway
    111153427
   04024 cAMP signaling pathway
    111153427
   04022 cGMP-PKG signaling pathway
    111153427
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111153427
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111153427
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111153427
   04062 Chemokine signaling pathway
    111153427
  09152 Endocrine system
   04911 Insulin secretion
    111153427
   04922 Glucagon signaling pathway
    111153427
   04923 Regulation of lipolysis in adipocytes
    111153427
   04912 GnRH signaling pathway
    111153427
   04913 Ovarian steroidogenesis
    111153427
   04915 Estrogen signaling pathway
    111153427
   04914 Progesterone-mediated oocyte maturation
    111153427
   04921 Oxytocin signaling pathway
    111153427
   04926 Relaxin signaling pathway
    111153427
   04935 Growth hormone synthesis, secretion and action
    111153427
   04918 Thyroid hormone synthesis
    111153427
   04928 Parathyroid hormone synthesis, secretion and action
    111153427
   04916 Melanogenesis
    111153427
   04925 Aldosterone synthesis and secretion
    111153427
   04927 Cortisol synthesis and secretion
    111153427
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111153427
   04270 Vascular smooth muscle contraction
    111153427
  09154 Digestive system
   04970 Salivary secretion
    111153427
   04971 Gastric acid secretion
    111153427
   04972 Pancreatic secretion
    111153427
   04976 Bile secretion
    111153427
  09156 Nervous system
   04724 Glutamatergic synapse
    111153427
   04727 GABAergic synapse
    111153427
   04725 Cholinergic synapse
    111153427
   04723 Retrograde endocannabinoid signaling
    111153427
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111153427
  09149 Aging
   04211 Longevity regulating pathway
    111153427
   04213 Longevity regulating pathway - multiple species
    111153427
  09159 Environmental adaptation
   04713 Circadian entrainment
    111153427
   04714 Thermogenesis
    111153427
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111153427
  09165 Substance dependence
   05032 Morphine addiction
    111153427
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111153427
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111153427
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111153427
   05163 Human cytomegalovirus infection
    111153427
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111153427
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111153427
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 111153427
NCBI-ProteinID: XP_022368145
UniProt: A0A2Y9KFF6
LinkDB
Position
Unknown
AA seq 1093 aa
MWREAMRRRRYLRDRAEAAAAAAGGGDGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMGA
CLALLAVFFALRLEVEDHVAFLITVPTALAIFFAIFILVCIESVFQKLLRLFSLVIWLCL
VAMGYLFMCFAGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCL
SATPGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEK
RQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIV
GFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKN
CVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHME
AGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPHLFR
PRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNR
TLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRATALP
AFKYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLVLAFTLFICFAGQLLQCSKKA
SASLLWLLKSSGIIADRPWPRVSLTVLTTAIILTMAVFNMFFLSDPEETILPTANTSNTS
LSALSNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVAYNTILL
HTHAHVLDDYSQVLFERPGIWKDLKTMGSVSLFIFFVTLLVLGRQSEYYCRLDFLWKNKF
NKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYDCVCVMFASIPDFKE
FYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQE
HAQEPERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQY
DIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGELKTYFVNT
EMSRSLSQSNLAS
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgtggcgggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggcggcggcg
gcggcggcgggcggcggcgacgggctgcagcggtcccgggactggctctatgagtcctac
tactgcatgagccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggcgcc
tgcctcgccctactcgccgtcttcttcgcgctccggctggaagttgaagaccacgtggca
tttttaataacggtcccgacagccctggcgattttcttcgcgatcttcatcctcgtctgc
atcgagtccgtgtttcagaagctgctccgtcttttctctctggtgatctggctgtgcctc
gtggccatggggtacctgttcatgtgctttgcaggcaccgtctctccctgggaccaggta
tcattcttcctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgagagat
gccatcatcgccagcgtgctcacctcctcctcccacaccatcgtgctgagcgtctgcctc
tctgcgaccccgggggccaaggagcacctggtctggcagatcctggccaacgtgatcatt
ttcatctgtgggaacctggcgggcgcgtaccacaaacatctcatggagctcgccctgcaa
cagacctaccaggacacgtgcaactgtatcaagtctcgaatcaagctggaatttgaaaag
cggcagcaggagcggctgctgctctccctgctgcccgcgcacatagccatggagatgaaa
gccgagatcatccagaggctgcagggccccaaagccggccaaatggaaaacacgaacaac
tttcacaacctgtatgtcaagcgacacaccaacgtgagcatcctgtacgcagacatcgtt
ggcttcacccggctggccagtgactgctctccaggagaactcgtccacatgctgaacgag
ctctttggaaagtttgaccaaattgcaaaggagaacgaatgcatgagaataaagattttg
ggagactgctactactgcgtgtccggactccccatatctctcccgaaccacgccaagaac
tgtgtgaaaatggggctggacatgtgtgaagccataaagaaagtgagggacgccactgga
gtggatatcaacatgcgcgtgggagtgcattctggcaatgtcctctgcggggtgattggt
ctgcagaagtggcagtatgacgtgtggtcacatgatgttaccttggccaatcacatggaa
gccggaggggtccctggacgtgttcacatttcttccgtcactttggagcacttgaatggc
gcttataaagtggaggaaggagacggtgacatcagagacccgtatttaaaacagcaccta
gtgaaaacctactttgtaatcaaccccaagggagagcgaaggagtcctcacctcttcaga
cctcgccacactctcgatggagccaagatgagggcctccgtgcgcatgacccggtacctg
gagtcctggggagcagccaagcccttcgcacacctgcatcaccgagacagcatgaccaca
gagaacggcaagatcagcaccacggatgtgccaatgggtcagcataattttcagaatcgc
accttgagaaccaagtcccaaaagaagagatttgaagaagaattgaatgaaaggatgatt
caagcaattgatggaattaatgcccaaaagcagtggctgaagtctgaagacattcagagg
atctcgctcctattctacaataaaatactagagaaagaataccgagccaccgccctgcca
gcgtttaagtactacgtgacctgtgcgtgtctcattttcttctgcatcttcattgtgcag
atcctagtattaccgaaaacgtccgtcctggggatctccttcggagctgcatttctcgtg
ctcgccttcaccctcttcatctgctttgcgggacagcttttgcaatgcagcaagaaagcc
tcggcctctctcctgtggctgttgaagtcgtcgggcatcatcgcggaccggccctggccg
cgcgtctctctcaccgtcctcaccacggccatcattctgaccatggctgtgttcaacatg
tttttcctgagtgacccagaggaaacaattcttccaactgccaatacatccaacacaagt
ctttccgccttaagtaatcaggcagcaattctgcgggcacaaaatctgtttttcctcccg
tacttcatctacagctgcatcctgggactgatttcctgctcggtcttcctgagggtcaac
tacgagctgaagatgttgatcatgatggtggcgttggtggcctacaacaccatccttctg
cacactcacgcccacgtcctggacgactacagccaggtcttattcgagagaccaggcatt
tggaaagacctgaagaccatgggctcagtgtctctctttatattcttcgtcacactgctc
gttctgggtagacagagtgaatattactgtaggttagacttcttatggaagaacaagttc
aacaaagagcgggaggagatagaaaccatggagaacctgaaccgcgtgctgctggagaac
gtgctgcccgcccacgtggcggagcatttcctggcccggagcctgaagaacgaggactta
taccaccagtcctatgactgtgtctgtgtcatgtttgcctctattccggatttcaaagaa
ttctacacggaatcagatgtgaacaaggagggcttggaatgccttcggctcctgaatgag
atcatcgccgacttcgatgatctgctgtccaagccgaaattcagtggagttgaaaagatc
aagaccattggcagcacgtacatggcggcgacgggtctgagcgccgtgcccagccaggag
cacgcccaggagcccgagcggcagtacatgcacatcggcaccatggtggagttcgccttc
gcgctggtggcgaagctggacgccatcaacaagcactccttcaacgacttcaagctgcgc
gtcggtattaaccatggacctgtgatagcgggtgtcattggagctcagaagccgcagtat
gatatctggggcaacaccgtaaatgtggccagcaggatggacagcaccggtgtgctggac
aaaatacaggtcaccgaggagacaagcctcatcctccagaccctcgggtacacatgcacc
tgcagaggaataatcaacgtgaaaggcaagggggagctgaagacatactttgtaaacaca
gaaatgtcaaggtccctttcccagagcaacctggcatcctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111154044
Entry
111154044         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04740  Olfactory transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111154044
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111154044
   04371 Apelin signaling pathway
    111154044
   04020 Calcium signaling pathway
    111154044
   04072 Phospholipase D signaling pathway
    111154044
   04024 cAMP signaling pathway
    111154044
   04022 cGMP-PKG signaling pathway
    111154044
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111154044
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111154044
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111154044
   04062 Chemokine signaling pathway
    111154044
  09152 Endocrine system
   04911 Insulin secretion
    111154044
   04923 Regulation of lipolysis in adipocytes
    111154044
   04912 GnRH signaling pathway
    111154044
   04913 Ovarian steroidogenesis
    111154044
   04915 Estrogen signaling pathway
    111154044
   04914 Progesterone-mediated oocyte maturation
    111154044
   04921 Oxytocin signaling pathway
    111154044
   04926 Relaxin signaling pathway
    111154044
   04935 Growth hormone synthesis, secretion and action
    111154044
   04918 Thyroid hormone synthesis
    111154044
   04928 Parathyroid hormone synthesis, secretion and action
    111154044
   04916 Melanogenesis
    111154044
   04925 Aldosterone synthesis and secretion
    111154044
   04927 Cortisol synthesis and secretion
    111154044
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111154044
   04270 Vascular smooth muscle contraction
    111154044
  09154 Digestive system
   04970 Salivary secretion
    111154044
   04971 Gastric acid secretion
    111154044
   04972 Pancreatic secretion
    111154044
   04976 Bile secretion
    111154044
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111154044
  09156 Nervous system
   04724 Glutamatergic synapse
    111154044
   04727 GABAergic synapse
    111154044
   04725 Cholinergic synapse
    111154044
   04723 Retrograde endocannabinoid signaling
    111154044
  09157 Sensory system
   04740 Olfactory transduction
    111154044
   04750 Inflammatory mediator regulation of TRP channels
    111154044
  09149 Aging
   04211 Longevity regulating pathway
    111154044
   04213 Longevity regulating pathway - multiple species
    111154044
  09159 Environmental adaptation
   04713 Circadian entrainment
    111154044
   04714 Thermogenesis
    111154044
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154044
  09165 Substance dependence
   05032 Morphine addiction
    111154044
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111154044
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111154044
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154044
   05163 Human cytomegalovirus infection
    111154044
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111154044
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111154044
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 111154044
NCBI-ProteinID: XP_022369106
UniProt: A0A2Y9K6S8
LinkDB
Position
Unknown
AA seq 1213 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLLVAAMGLLLDLL
LFVLCKKGLLPDRVTRKVVPYVLWLLITAQIFSYLGLNFSRAHAASDTVGWQTFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGTHLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGEGGSRCE
YLDEKGIETYLIIASKPEVKKTAAQHGLGGPALLNGAPASSKPGSPALIETKEPSGSVHT
SGSTSEEPEDQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPDMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YMTFVVGEVLLLILTVCSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPNNSTTGLDVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAVINIYAWRPIFDEYDRKRFQEHDFPVVALEKMQGLSTPGLNSTGRLPLVPSK
YSMTVMVFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFAGSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVWPAAEQSMCSEAGAGNKIGLGRVAMRSCLSIGPGYQGGSSGRSRARVGNTSLPF
PRLGLKLLVTLSFWYELSNLSYHRQLPPEAAPNHASCVWQESTTKQGEGTQEQGVMLPET
TQGCPSGQRALLL
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaacctgagtactcggccgagtactccgcggagtac
tcggtcagcctgccctctgaccctgaccgcggagtgggccggacccacgaaatctcggtc
cggaactcgggatcctgcctctgcctgcctcggttcatgcgactgaccttcgtgcccgag
tccttggagaacttgtatcagacctacttcaaacggcagcgtcacgagaccctgctggtg
ctggtggtgttcgcggccctctttgactgctacgtggtggtgatgtgcgccgtggtcttc
tccagcgacaagctggctcctctcctcgtggcggccatgggactgctgttggacctcctc
ctcttcgtgctctgcaaaaaggggctgctccccgaccgggtcacccggaaagtggtgccc
tacgtgctgtggctgctgatcaccgcccagattttctcctacctgggcctgaacttttcg
cgagcccatgcagccagcgacacggtgggctggcagaccttcttcgtattctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgtgttgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggacgggctgaagggcacg
cacttgctgagggagatcctggccaatgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggctgatgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagcatc
ctctttgcggacatcgtgggcttcacccagctgtcctcggcctgcagcgcccaggagctc
gtgaagctgctcaatgagctgtttgcccgcttcgacaagctggctgccaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcctgcccgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagacaggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaaacgctggcagtacgacgtgtggtcgaccgacgtcact
gtggccaacaagatggaggctggtggcatccccgggcgtgtgcacatctcccagagcacc
ctggactgcctgaagggcgagttcgacgtggagccaggcgaggggggcagccgttgtgag
tacctagacgagaagggcatcgagacctacctcatcatcgcgtccaagccggaggtgaag
aagacagccgcccagcatggcctcggcggtccggccctgctgaacggcgccccggcctcc
tccaagcccggctcccccgccctcattgagaccaaggagcctagcgggagtgtccacacc
agcggctccacgtcggaggagcccgaggaccaggatgcccaggccgacaatccctcgttc
cccaacccgcgccggaggctgcgccttcaggacctggcggaccgagtggtggacgcctct
gaggacgagcacgagctcaaccagctgctaaacgaggcgctgctggagcgagagtccgcc
caggtagtgaagaagagaaacacctttctcctttccatgcggttcatggaccccgatatg
gaaacccgctactcggtggagaaggaaaagcagagtggggctgccttcagctgctcctgt
gttgtcctgctctgtacggccctggtcgagatactcatcgacccctggctaatgaccaac
tacatgacctttgtggttggggaggttctgctgctgatcctgacggtctgctcgctggct
gccatctttccccgggcctttcctaagaagctcgttgccttctcgacctggatcgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattctggtcatggcaaac
gtcgtggacatgctcagctgtctccagtactacaccgggcccaataacagcaccacaggg
ctggacgtagaggacggctgcgtggagaaccccaagtattacaactatgttgccgttctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgctcgtcgcgggggccgtggccgtcatcaacatctacgcctggcgccccatctttgat
gagtacgaccgcaagcgctttcaggaacacgactttcccgtggtcgccttagagaagatg
cagggactttccacccctgggctcaacagcactggcaggctgcccctggtgccctctaag
tactccatgaccgtgatggtcttcgtcatgatgctgagcttctactacttctcgcgccat
gtggaaaaactggcaaggacactgttcttgtggaagattgaagtccatgaccagaaagaa
cgtgtctacgagatgcggcgctggaatgaggccttggtcaccaacatgctgcctgagcac
gtggcccgccatttcctggggtccaagaagagagacgaggagctgtacagccagtcctac
gacgagatcggagtcatgttcgcctccctgcccaacttcgccgacttctacacggaggag
agcatcaacaacggcggcatcgagtgtctgcgcttcctcaacgagatcatctcagacttt
gattctctgctggacaaccccaaattccgggtcatcaccaagatcaaaaccatcggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaacggctttgccggctcc
aacaaggaggagaagtccgacaaggagcgctggcagcacctggctgatctggcggacttt
gctctggccatgaaggacacgctcacaaacatcaacaaccagtccttcaacaacttcatg
ctgcgcatcggcatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaatacggtcaatgtggccagcaggatggagtccacgggggtc
atgggcaacattcaggtatggccagcagcagagcagagcatgtgctcagaagcaggggcc
gggaacaagatcggactagggcgtgttgccatgcgctcctgcctgtccattggcccaggg
tatcaagggggtagctctggaaggtcgcgggcaagggtgggaaatacttcactccccttt
ccaagacttgggcttaagcttttggtaaccctatccttttggtatgaactttctaatctc
tcgtaccaccgccaacttccccctgaagccgccccgaatcatgccagctgcgtctggcag
gagagcaccacaaagcagggagaggggacacaagaacagggagtgatgctgccagagaca
acccagggctgtccttcgggtcagcgagcgctattgctgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111155044
Entry
111155044         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04727  GABAergic synapse
elk04728  Dopaminergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05012  Parkinson disease
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05034  Alcoholism
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111155044
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111155044
   04371 Apelin signaling pathway
    111155044
   04072 Phospholipase D signaling pathway
    111155044
   04024 cAMP signaling pathway
    111155044
   04022 cGMP-PKG signaling pathway
    111155044
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111155044
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111155044
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111155044
   04062 Chemokine signaling pathway
    111155044
  09152 Endocrine system
   04911 Insulin secretion
    111155044
   04923 Regulation of lipolysis in adipocytes
    111155044
   04912 GnRH signaling pathway
    111155044
   04913 Ovarian steroidogenesis
    111155044
   04915 Estrogen signaling pathway
    111155044
   04914 Progesterone-mediated oocyte maturation
    111155044
   04921 Oxytocin signaling pathway
    111155044
   04926 Relaxin signaling pathway
    111155044
   04935 Growth hormone synthesis, secretion and action
    111155044
   04918 Thyroid hormone synthesis
    111155044
   04928 Parathyroid hormone synthesis, secretion and action
    111155044
   04916 Melanogenesis
    111155044
   04924 Renin secretion
    111155044
   04925 Aldosterone synthesis and secretion
    111155044
   04927 Cortisol synthesis and secretion
    111155044
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111155044
   04270 Vascular smooth muscle contraction
    111155044
  09154 Digestive system
   04970 Salivary secretion
    111155044
   04971 Gastric acid secretion
    111155044
   04972 Pancreatic secretion
    111155044
   04976 Bile secretion
    111155044
  09156 Nervous system
   04724 Glutamatergic synapse
    111155044
   04727 GABAergic synapse
    111155044
   04725 Cholinergic synapse
    111155044
   04728 Dopaminergic synapse
    111155044
   04726 Serotonergic synapse
    111155044
   04723 Retrograde endocannabinoid signaling
    111155044
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111155044
  09149 Aging
   04211 Longevity regulating pathway
    111155044
   04213 Longevity regulating pathway - multiple species
    111155044
  09159 Environmental adaptation
   04713 Circadian entrainment
    111155044
   04714 Thermogenesis
    111155044
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111155044
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111155044
  09165 Substance dependence
   05030 Cocaine addiction
    111155044
   05031 Amphetamine addiction
    111155044
   05032 Morphine addiction
    111155044
   05034 Alcoholism
    111155044
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111155044
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111155044
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111155044
   05163 Human cytomegalovirus infection
    111155044
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111155044
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111155044
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 111155044
NCBI-ProteinID: XP_022370780
UniProt: A0A2Y9KNI4
LinkDB
Position
Unknown
AA seq 1261 aa
MSGSKSVSPPGYAAQIAAAPASRGGPEHRSAWGEADSRANGYPHAPGGSTRGCTKKSGGA
VTPQQQQQRLANRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQR
RGAAGGGSTRAPPAGGGGGSAAAAAAAGGTEVRPRSVELGLEERRGKGSAVDELEAGAVE
GDEGSGDGGSSAESGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQSS
LTMLMAVLVLVCLVMLAFHAVRPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHMGLA
CYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALH
LAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHS
QRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSL
ASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMG
MDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKA
GRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNR
QRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLG
RAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQIT
IVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQTLSRKIVRSKMNSTLVGVFT
ITLVFLSAFVNMFTCNSENLLGCLADEHNISTGQVNACHVVASASNYSLGAEQGFCRSPW
PSCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELTYVLIVEVPRVTLFDNADLL
VTANAIDFNNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKL
QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANF
SEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTY
DKVGKSHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
NTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPL
S
NT seq 3786 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgcggcgcagatagctgcggcgccg
gcgtcccggggaggcccggaacaccgttcggcgtggggggaggcggattcccgcgccaat
ggctacccccacgcccccgggggttcgacccgcggctgcaccaagaaatccgggggggcg
gtgaccccgcagcagcagcagcagcgcttggctaaccgctggcgcagcgacgacgacgac
gatcctccgctgagcggcgacgaccccctggccgggggctttggcttcagtttccgctcc
aagtcggcctggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcagcgc
cggggcgcggctggcgggggcagcacccgggcgccccctgcgggcggcggtggcggctcg
gcggcggcagctgccgcggccggcgggacggaggtgcgccctcgctcggtggagctgggc
ctggaggagcggcggggcaagggcagcgcggtggacgagttggaggccggcgccgtcgag
ggcgacgaagggtctggggatggcggcagctcggcagaatcaggcgcggggcccggcgca
gtgctgtcgctgggcgcctgctgcctggcgctgctgcagatattccgctccaagaagttc
ccgtcggataagctggagcggctgtaccagcgctacttcttccgtctgaaccagagcagc
ctcactatgctcatggccgtgctggtgctcgtgtgcctcgtcatgttggccttccacgcg
gtgcggcccccgctccagctgccctacctggcagtgctggcggctgcggtaggtgtcatc
ctcgtcatggctgtgctctgcaatcgcgccgccttccaccaggaccacatgggcctggcc
tgctacgcgctcatcgccgtggtgctggccgtccaggtggtgggcctgctgctgccccag
ccacgcagcgcctcggagggcatctggtggacggtgttcttcatctacaccatctacacg
ttgctgcctgtgcgcatgcgtgccgcggtactcagcggagtgctcctgtctgccctccac
ctggccatagccctgcgcaccaacgcccaggaccagttcctgctcaagcagcttgtctcc
aatgtcctcattttctcctgcaccaacatcgtgggtgtctgcacccactacccggctgag
gtctcccagagacaggccttccaggagacccgggagtgcatccaggcacgactccactca
caacgggagaaccagcaacaggagcggctcctgctgtctgtcctgccccgtcacgttgcc
atggagatgaaagcagacatcaatgccaagcaggaggatatgatgttccataagatttac
atccagaaacatgacaacgtgagcatcctgtttgccgacatcgagggcttcaccagcctg
gcatcccagtgcactgcccaggagctggtcatgaccctcaacgagctcttcgcccgcttt
gacaagctggctgcggagaatcactgtttacgtattaagatcctgggggattgttattac
tgtgtctctgggctgccggaagcgagggctgaccatgcccactgctgtgtggagatgggc
atggacatgattgaggccatctcgttggtccgggaggtgacaggggtgaacgtgaacatg
cgcgtgggaattcacagcgggcgagtacactgcggtgtccttggtctcaggaagtggcag
ttcgacgtctggtctaatgacgtcacgctggccaaccacatggaagctggaggcaaggca
gggcgtatccacatcaccaaggccacgctcaactacctgaatggggactacgaggtggag
ccgggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagaccttcctc
atcctgcgctgtacccagaagcggaaagaagaaaaggccatgattgccaagatgaatcgc
cagagaaccaactccattgggcacaacccaccccactggggggccgagcgtcccttctac
aaccacctggggggcaaccaggtgtccaaggagatgaagcggatgggcttcgaagacccc
aaggacaagaatgcccaagaaagtgcaaaccctgaggatgaagtggatgagtttctgggc
cgcgccattgacgccaggagcatcgacaggctgcggtctgagcatgtccgcaagttcctc
ttgaccttcagggagcctgacttagagaagaagtactccaagcaggtggatgaccgattt
ggtgcctacgtggcctgtgcctcgcttgtcttcctcttcatctgctttgtccaaatcacc
atcgtgccccactccgtgttcatgttgagtttctacctgacctgtttcctgctgctgacg
ttggtggtatttgtgtccgtgatctactcctgcgtgaagctcttcccagccccactgcag
accctctccaggaagatcgtgaggtccaagatgaacagcactctggtcggtgtgttcacc
atcaccctcgtgttcctgtcggctttcgtcaacatgttcacgtgtaactcggagaacctg
ctgggctgcctggcggacgagcacaacatcagcactggccaggtcaacgcgtgccatgtg
gtggcctcggcctccaactacagcctgggggccgagcagggcttctgccgcagcccgtgg
cccagctgcaacttccctgagtacttcacctacagcgtgctgctcagcctgctggcctgc
tccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccattgagctc
acatacgtgctcatcgtcgaggtgccccgcgtcacactctttgacaatgctgacctgctg
gtcaccgccaatgccatagacttcaacaacaacaacgggacctcccagtgccccgagcat
gcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctcggtgttcgtgctggcc
ctgtacctgcatgcccagcaagtggagtccactgcccgcctggacttcctctggaaactg
caggccacggaggagaaggaggagatggaggagctgcaggcctacaacaggcggctgctg
cacaacatcctgcccaaggacgtggccgcccacttcctggcccgtgagcggcgcaacgac
gagctctactaccagtcgtgcgagtgtgtggccgtcatgttcgcctccatcgccaacttc
tctgagttctacgtggagctggaggccaacaatgagggcgtggagtgcctgcggctgctc
aatgagatcattgccgactttgacgagatcatcagcgaggatcggtttaggcagctggaa
aagatcaagaccattggcagcacctacatggccgcctcaggcctcaatgactctacgtac
gacaaggtgggcaagagccacatcaaagccctggccgactttgccatgaagctcatggac
caaatgaagtacatcaatgaacactccttcaacaacttccagatgaagattgggctcaac
atcggccccgtggtggctggggtgatcggggctcgcaagcctcagtacgacatctggggc
aatacagtgaacgtggccagccgcatggacagcaccggtgtgcctgaccgcatccaggtc
accacggacatgtaccaggtgctggctgccaacacttaccagctggagtgcaggggtgtg
gtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaacggggggcccccgctc
agttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156133
Entry
111156133         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111156133
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111156133
   04371 Apelin signaling pathway
    111156133
   04020 Calcium signaling pathway
    111156133
   04072 Phospholipase D signaling pathway
    111156133
   04024 cAMP signaling pathway
    111156133
   04022 cGMP-PKG signaling pathway
    111156133
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111156133
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111156133
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111156133
   04062 Chemokine signaling pathway
    111156133
  09152 Endocrine system
   04911 Insulin secretion
    111156133
   04923 Regulation of lipolysis in adipocytes
    111156133
   04912 GnRH signaling pathway
    111156133
   04913 Ovarian steroidogenesis
    111156133
   04915 Estrogen signaling pathway
    111156133
   04914 Progesterone-mediated oocyte maturation
    111156133
   04921 Oxytocin signaling pathway
    111156133
   04926 Relaxin signaling pathway
    111156133
   04935 Growth hormone synthesis, secretion and action
    111156133
   04918 Thyroid hormone synthesis
    111156133
   04928 Parathyroid hormone synthesis, secretion and action
    111156133
   04916 Melanogenesis
    111156133
   04925 Aldosterone synthesis and secretion
    111156133
   04927 Cortisol synthesis and secretion
    111156133
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111156133
   04270 Vascular smooth muscle contraction
    111156133
  09154 Digestive system
   04970 Salivary secretion
    111156133
   04971 Gastric acid secretion
    111156133
   04972 Pancreatic secretion
    111156133
   04976 Bile secretion
    111156133
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111156133
   04961 Endocrine and other factor-regulated calcium reabsorption
    111156133
  09156 Nervous system
   04724 Glutamatergic synapse
    111156133
   04727 GABAergic synapse
    111156133
   04725 Cholinergic synapse
    111156133
   04723 Retrograde endocannabinoid signaling
    111156133
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111156133
  09149 Aging
   04211 Longevity regulating pathway
    111156133
   04213 Longevity regulating pathway - multiple species
    111156133
  09159 Environmental adaptation
   04713 Circadian entrainment
    111156133
   04714 Thermogenesis
    111156133
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156133
  09165 Substance dependence
   05032 Morphine addiction
    111156133
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111156133
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111156133
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111156133
   05163 Human cytomegalovirus infection
    111156133
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111156133
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111156133
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2
Other DBs
NCBI-GeneID: 111156133
NCBI-ProteinID: XP_022372487
UniProt: A0A2Y9KFD7
LinkDB
Position
Unknown
AA seq 1352 aa
MASPPHQQLLPHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKRCKYSISSSCSSSGDS
GGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKLMVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGHVDSSNRTLAAKPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVVYSVLFETFGYHFRDKDCFPPPGAWAPHWELLSRALLHVCIHAIGVHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLIAGQRVKAPHCSCSQALLSGFEVIDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCQEEHKS
STKAPGAPNSKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAASTSPPPAALAVFGAALLLEVLSLVVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHITSEFETNIHVTVFMGS
AVLITVVHYCNFCQLSSWMRSSLATVVGAGPLLLLCISLCPDSSIVISHLDAGQNFSSEG
NPCNSSLPHGGGTASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKI
QSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKEC
YRVLNELIGDFDELLSRPGYSSIEKIKTIGATYMAASGLNGAQCQDGGHPQEHLQVLFEF
AKEMMRVVDDFNSNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTG
VECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDSGAVPQHQLSISPD
IRVQVDGSIGRSPTDEIANLVPSVQNADKTSLGSENNMQAKDAHLSSNRPWKEPIKPEER
SRFGKAIEKSNCEEVGVEEASELTRLNVSKSV
NT seq 4059 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgccgcaccacagcaccgaggtgagttgtgac
tccagcggagacagcaacagcgtgagggtcaaaatcaaccccaagcagctgtcctccaac
agccaccccaagcgctgcaagtacagcatctcctccagctgtagcagctctggggactca
gggggcgtcccccggagagtgggcgctggaggccgcctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggaccccaagttcgactcggtgaacctg
gaggaggcttgcatggagcgctgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgcctcctgtggagcatctattttggcgtccacatgcggtcc
aaactgatggtcatggtagccccagctctgtgcttccttgtcgtgtgtgtgggctttttt
ctgtttaccttcaccaagctgtatgcccggcattacgtgtggacctctctggttctcacc
ctcctggtgttcgccctgaccctggccgcccagtttcaggttttgacgcctctctcagga
catgttgacagctccaatcgtacccttgcagccaagcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgtttttgggagtagtctattctgtactctttgagacctttggc
tatcatttccgagacaaagactgctttcccccacctggagcatgggcaccacactgggag
ctgctgagccgagccctgctccacgtctgcattcacgccatcggggtccacctatttatc
atgtcccaggtgagatccaggagcacctttctcaaggtgggacagtcaattatgcatgga
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgcccagg
atcatagctgatgacctgatgaaacagggggatgaggagagcgagaattctgtcaaaagg
cacgccacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccccata
gcatttcgccctttcaaaatgcagcagatcgaagaagtcagtattctatttgcagatatc
gtgggcttcaccaagatgagtgccaataagtctgctcacgccctggtgggtcttctcaat
gatctgttcggtcgctttgaccggttgtgtgaagagaccaagtgtgagaaaatcagtacc
ctgggagactgctactattgcgtggcggggtgtccagagccccgggccgaccatgcctac
tgctgcattgagatgggcttgggcatgatcagagcgatcgagcagttctgccaggagaag
aaagagatggtgaacatgcgcgtcggggttcacacggggaccgtcctctgcggcatcttg
ggcatgaggaggttcaaattcgatgtgtggtccaacgatgtgaacttggccaatctcatg
gagcagctgggagtggcgggcaaggttcacatttccgaggccacagcaaaatacctagat
gatcggtacgaaatggaagatgggaaagttactgaacgccttggccagagcgttgttgct
gatcagttgaaaggtttgaagacatacctgatagcgggtcagagagtgaaggcgcctcat
tgcagctgttcacaggccttgctttctggctttgaggtcattgacggctcacgggtgtcc
tcaggtcctaggggacaggggacagcatcaccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacttgtccttcctgcggaatcacatttgcccccaaa
tcagaagcgggtgcagaaggaggagcggtccagaacggctgtcaagaggagcataaaagc
agcaccaaggctcctggagcaccgaattccaaaactcagaacggacttctgagccctccc
caagaggagaaactcaccaacagtcagacctccctgtgtgagatcttacaggaaaaggga
aggtgggcaggagtgagcttggaccagtcagctctccttccgctgaggttcaagaacatc
cgggagaaaacagatgcccattttgttgacgttatcaaagaggacagcctgatgaaagat
tattttttcaagccacccatcaatcagttcagcttgaacttcttggatcaggagttagag
cgatcctacaggaccagctatcaagaagaggttataaagaattctcccgtgaagactttt
gccagtgccaccttcagctccctgctagatgtgtttctgtcgacaacagtttttctgatt
ctctccatcacctgctttctgaagtatggggctgcctccacgtctcccccacctgccgcc
ctggcagtcttcggcgctgccctgctgctggaggtgctgtccctcgtggtctccatcagg
atggtgtttttcctggaggacgtgatggcttgtacaaagcgcctgctggagtggatagct
ggctggctcccacgccatttcattggggccatcctggtgtcactccctgctcttgcggtc
tattcacacatcacctctgaatttgagacaaacatacacgtcaccgtgttcatgggttca
gccgtcctgatcaccgtcgtgcactactgtaacttttgccagctcagctcctggatgagg
tcctccttagccacagtcgtcggggcagggcccctgctcctgctctgcatctccctgtgc
cctgacagttccatagtaatttcacaccttgatgcaggacagaatttcagttctgagggg
aatccgtgcaatagttccttgcctcatggtggcggaacagccagcctgattggccaggag
gtggttctggtcttctttctcctgctcttgttggtctggttcctgaatcgagaattcgag
gtcagctaccgcctgcactaccatggggacgtggaggcagaccttcaccgcaccaagatc
cagagcatgagggaccaagccgactggctgctaaggaacatcatcccctaccacgtggct
gagcagctgaaggtctcccagacctactccaagaaccacgacagtggaggcgtcatcttc
gccagcatcgtcaacttcagtgagttctacgaggagaactatgaggggggcaaggagtgc
taccgggttcttaacgagctcattggggacttcgacgagctcctgagcaggccaggctac
agcagcatcgagaagatcaagaccattggggccacatacatggctgcatcggggctgaac
ggcgcccagtgccaggacggtggccacccacaggagcacctgcaggtcctgttcgagttt
gccaaggagatgatgcgcgtggtggacgacttcaacagcaacatgctgtggttcaacttc
aagctcagggtcggcttcaaccatgggccactcacagcaggggtcatcggcaccacgaag
ctgctatatgacatctggggcgacactgtcaacatcgccagcaggatggacagcacaggg
gtggagtgccgcatccaggtgagtgaggagagctaccgtgtcctgagcaagatgggctac
gactttgactaccgggggacagtgaatgtgaagggcaagggccagatgaagacctacttg
tacccaaagtgcatggacagcggggccgtgccgcagcaccagctgtccatctccccggac
atccgagtccaggtggacggcagcatcgggcggtctcccacggacgagattgccaacctg
gtgccttctgtacagaatgcggacaagacgtctctgggttccgaaaataacatgcaggcc
aaggacgctcacctgtcctctaacaggccgtggaaggagcccatcaaacctgaagagagg
tctcgatttggcaaagccatagagaaaagcaactgtgaagaagtgggcgtggaagaagcc
agcgaactcaccaggctcaatgtttccaagagcgtgtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157054
Entry
111157054         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05142  Chagas disease
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111157054
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111157054
   04371 Apelin signaling pathway
    111157054
   04020 Calcium signaling pathway
    111157054
   04072 Phospholipase D signaling pathway
    111157054
   04024 cAMP signaling pathway
    111157054
   04022 cGMP-PKG signaling pathway
    111157054
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111157054
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111157054
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111157054
   04062 Chemokine signaling pathway
    111157054
  09152 Endocrine system
   04911 Insulin secretion
    111157054
   04923 Regulation of lipolysis in adipocytes
    111157054
   04912 GnRH signaling pathway
    111157054
   04913 Ovarian steroidogenesis
    111157054
   04915 Estrogen signaling pathway
    111157054
   04914 Progesterone-mediated oocyte maturation
    111157054
   04921 Oxytocin signaling pathway
    111157054
   04926 Relaxin signaling pathway
    111157054
   04935 Growth hormone synthesis, secretion and action
    111157054
   04918 Thyroid hormone synthesis
    111157054
   04928 Parathyroid hormone synthesis, secretion and action
    111157054
   04916 Melanogenesis
    111157054
   04925 Aldosterone synthesis and secretion
    111157054
   04927 Cortisol synthesis and secretion
    111157054
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111157054
   04270 Vascular smooth muscle contraction
    111157054
  09154 Digestive system
   04970 Salivary secretion
    111157054
   04971 Gastric acid secretion
    111157054
   04972 Pancreatic secretion
    111157054
   04976 Bile secretion
    111157054
  09156 Nervous system
   04724 Glutamatergic synapse
    111157054
   04727 GABAergic synapse
    111157054
   04725 Cholinergic synapse
    111157054
   04720 Long-term potentiation
    111157054
   04723 Retrograde endocannabinoid signaling
    111157054
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111157054
  09149 Aging
   04211 Longevity regulating pathway
    111157054
   04213 Longevity regulating pathway - multiple species
    111157054
  09159 Environmental adaptation
   04713 Circadian entrainment
    111157054
   04714 Thermogenesis
    111157054
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157054
  09165 Substance dependence
   05032 Morphine addiction
    111157054
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111157054
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111157054
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111157054
   05163 Human cytomegalovirus infection
    111157054
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111157054
   05142 Chagas disease
    111157054
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111157054
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111157054
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 111157054
NCBI-ProteinID: XP_022373975
UniProt: A0A2Y9KXS1
LinkDB
Position
Unknown
AA seq 1138 aa
MAGAPRGRGGGGGGGGGGGGAGEPGGAERAAGPGGRRGLRPCGEEFACPELEALFRGYTL
RLEQAATLKALAVLSGLAGALALAELLGAPGPAAGLARGSHPAHCVLFLALLVVTNVRSL
QASQLQQVGQLALLFSLTFALLCCPFALGGPAGTHAGAASGTAAADHGVWQLLLVTFVSY
ALLPVRSLLAVGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFLSVNMYGVFVRVL
AERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKI
YIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCY
YCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKW
QYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSFLKAHNIETF
FIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRRMFRAEIPFSNVMTCEDDD
KRRALRTASEKLRNRSSFSANVVHTAPGTRVNRYIGRLLEARQMELEMADLDFFTLKYKQ
AERERKYHQLQDDYFTCAVVLALVLAAVFGLVYLLIIPQSVVVLLLLVFCICFLVACVLY
LHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSSPNGSLVVLAPGG
RNALLPAAPCESAPHALLCGLVGTLPLAVFLRVSSLPKMILLFVLTASYILVLELSGYTR
ASGGGAVSGRSFEPIVAVLLFSCTLALHARQVDVKLRLDYLWAAQAEEERDDMERVKLDN
KRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFDDFYIELDGNNMGVEC
LRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLVPTAGSKAKKCISSHLSTLAD
FAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTG
VQGRIQVTEEVHRLLRKGTYRFVCRGKVSVKGKGEMLTYFLEGRTDRNGSQARSLNAERK
MCAYGRPGLQTKLGTGPPPMAPMAGPPVRAGLGALQGSGLPPGPHGQHPPPGAAGKEA
NT seq 3417 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggccgaggcggaggcggcggcggaggcggaggcggcggcggc
gcgggcgagcccgggggcgccgagcgggcggcggggccgggcggccggcgcgggctgcgg
ccgtgcggcgaggagttcgcgtgccccgagctggaggcgctgttccgcggctacacgctg
cggctggagcaggcggccacgctgaaggcgctggccgtgctcagcgggctggcgggcgcg
ctggcgctggcggagctgctgggcgcgccggggcccgcggccggcctggccaggggctcg
caccccgcgcactgcgtgctcttcctggcgctgctcgtggtcaccaacgtgcgctcgctg
caggcgtcgcagctgcagcaggtcggccagctggcgctgctgttcagcctcaccttcgcg
ctgctctgctgccccttcgcgctcggcgggcccgcgggcacccacgccggcgcggcttcg
gggacggcggccgccgaccacggcgtctggcagctccttttggtcaccttcgtgtcctat
gccctgctgcccgtgcgcagcctgctggccgtcggcttcgggctcgtggtggccgcctcg
catttgctggttacggccaccttggtgcccgccaagcgcccgcgtctctggaggacgctc
ggtgccaatgccctactcttcctcagtgtgaacatgtacggggtgtttgtgcgggtcctg
gccgaacgctcccaaaggaaagccttcctgcaagcccggaactgcattgaggaccggctc
aggctggaggatgagaacgagaagcaggagcggctgcttatgagtcttctgccccggaat
gttgccatggagatgaaggaggacttcctgaagccccccgagaggattttccacaagatc
tacatccagcggcacgacaatgtgagcatcctcttcgcggacatcgtgggcttcacaggc
ctggcgtcgcagtgcacagcccaggagctggtgaaactcctgaacgagctcttcggcaag
tttgacgaactggccacggagaaccactgccgccgcatcaagatcctcggggactgctac
tactgtgtgtcgggcctcacccagcccaagaccgaccacgcccactgctgcgtggagatg
gggctggacatgatcgacaccatcacgtcggtggccgaggccacggaggtggatctgaac
atgcgtgtggggctgcacactggccgggtcctctgcggggtcctcggcctgcgcaagtgg
cagtatgacgtgtggtccaatgacgtgacactggccaatgtcatggaggccgccggccta
cccgggaaggtccacatcaccaagacgaccctggcttgcttgaatggggactacgaggtg
gagccggggcatgggcacgagaggaacagtttcctgaaggctcacaacattgagaccttc
ttcatcgtgccgtcacaccggcggaagatatttccagggctgatcctgtccgacatcaag
cccgccaagaggatgaagttcaagacggtttgttacctgctggtgcagctcatgcactgc
cggaggatgttcagggcggagatccccttctccaacgtcatgacctgcgaggacgacgac
aagcggagggcgttgagaaccgcgtcggagaaactcagaaaccgctcgtccttctctgcc
aacgtcgtgcacaccgcgccgggcacgcgggtcaacaggtacatcggccgcctcctggag
gcgcgccagatggagctggagatggcggacctggacttcttcaccctgaagtacaagcag
gcggagcgcgagcgcaagtaccaccagctgcaggacgactacttcacctgtgccgtggtg
ctcgcgctcgtcctggccgccgtgttcggccttgtctacctgctcatcatcccgcagagc
gtggtcgtcctgctgctgctggtgttctgcatctgcttcctggtggcctgtgtcctgtac
ctgcacatcacccgggtccagtgttttccaggatgcctaactatccagattcgcaccgtc
ttgtgtattttcatcgtggtcctaatctactccgtggcccaaggctgtgtggtgggctgc
ctgccctgggcctggagctccagccccaacgggtccctggtggtcctggcgcccggcggc
cggaacgccctgctgcctgccgcgccctgcgagtcggccccccatgccctgctgtgcggc
ctcgtgggcaccctcccgctggccgtcttcctgcgggtgtcctcgctgcccaagatgatc
ttgctgtttgtgctcacggcgtcctacatcctggtcctggagctcagcgggtacacccgg
gcctcggggggtggcgcggtgtctgggcgcagcttcgagccgatcgtggccgtcctgctg
ttctcctgcacgctggccctgcacgcgcggcaggtggacgtcaagctgcggctggattac
ctgtgggcggcacaggcggaggaggagagggacgacatggagagggtgaagctggacaac
aagcggatcctcttcaacctcctgccggcccacgtcgctcagcacttcctcatgtccaac
ccccggaacatggacctgtactaccagtcctactcgcaggtgggcgtcatgttcgcctcc
atccccaactttgacgacttctacatcgagctggacggcaacaacatgggtgtggagtgc
ctgcgcctcctgaacgagatcatcgccgactttgatgagctcatggacaaagacttttac
aaggacctggagaagattaagaccatcgggagcacctacatggctgccgtggggctggtg
cccacggccgggtccaaggcaaagaagtgcatctcctcacacctcagcacgctggccgac
ttcgccatcgagatgtttgacgtcctggacgaaatcaactaccagtcttacaacgacttt
gtgctccgcgtcggcatcaacgttggccccgtggtggccggggtgatcggggctcgaagg
ccacagtatgacatttggggaaacacggtcaacgtggccagtcggatggacagcaccggt
gtccagggcagaatccaggtgaccgaggaggttcaccggctgctgcgaaagggcacctac
cgcttcgtgtgccgtgggaaggtcagcgtcaagggcaagggtgagatgctgacgtacttc
ctggaaggccgaaccgatagaaatggctcccaggccaggtccctgaacgcagagcggaaa
atgtgtgcttacgggcgacctggcctccagaccaaactgggcacaggcccgccccccatg
gcccccatggctggccccccagtcagagccgggctaggggctctgcagggctcggggctc
ccaccgggccctcacggccagcacccgccccccggagcagctgggaaggaggcttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157326
Entry
111157326         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111157326
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111157326
   04371 Apelin signaling pathway
    111157326
   04020 Calcium signaling pathway
    111157326
   04072 Phospholipase D signaling pathway
    111157326
   04024 cAMP signaling pathway
    111157326
   04022 cGMP-PKG signaling pathway
    111157326
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111157326
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111157326
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111157326
   04062 Chemokine signaling pathway
    111157326
  09152 Endocrine system
   04911 Insulin secretion
    111157326
   04923 Regulation of lipolysis in adipocytes
    111157326
   04912 GnRH signaling pathway
    111157326
   04913 Ovarian steroidogenesis
    111157326
   04915 Estrogen signaling pathway
    111157326
   04914 Progesterone-mediated oocyte maturation
    111157326
   04921 Oxytocin signaling pathway
    111157326
   04926 Relaxin signaling pathway
    111157326
   04935 Growth hormone synthesis, secretion and action
    111157326
   04918 Thyroid hormone synthesis
    111157326
   04928 Parathyroid hormone synthesis, secretion and action
    111157326
   04916 Melanogenesis
    111157326
   04925 Aldosterone synthesis and secretion
    111157326
   04927 Cortisol synthesis and secretion
    111157326
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111157326
   04270 Vascular smooth muscle contraction
    111157326
  09154 Digestive system
   04970 Salivary secretion
    111157326
   04971 Gastric acid secretion
    111157326
   04972 Pancreatic secretion
    111157326
   04976 Bile secretion
    111157326
  09156 Nervous system
   04724 Glutamatergic synapse
    111157326
   04727 GABAergic synapse
    111157326
   04725 Cholinergic synapse
    111157326
   04723 Retrograde endocannabinoid signaling
    111157326
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111157326
  09149 Aging
   04211 Longevity regulating pathway
    111157326
   04213 Longevity regulating pathway - multiple species
    111157326
  09159 Environmental adaptation
   04713 Circadian entrainment
    111157326
   04714 Thermogenesis
    111157326
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157326
  09165 Substance dependence
   05032 Morphine addiction
    111157326
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111157326
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111157326
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111157326
   05163 Human cytomegalovirus infection
    111157326
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111157326
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111157326
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 111157326
NCBI-ProteinID: XP_022374357
UniProt: A0A2Y9KMN0
LinkDB
Position
Unknown
AA seq 1076 aa
MPAKGRYFLNEGGEGPDQTALYEKYRLTSQHGPLLLTLLLVAVTACIALIVITFVCGDPS
GHQAVLGMAFFTLALFVTLYVLVYMECLVRRWLRTLALVIWVCLMMLGYTLVLDSWMKAA
PTWAQVPFFLFIVFVVYTLLPFSMRGAIMAGGVSSISHLLVLGVLMGAFTKPSDWVVRQL
VANAVIFLCGNLTGAFHKHQMQDASRELFTYAVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKERGDRRYVPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPKPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETPVPSGRRPKTIPLRRHRTPDRSSSPKGRS
EDDSYDEEMLSAIEGLSSTRPCCSKSDDFSTFGSIFLEKDFEREYRLAPIPRARHYFACA
SLIFVCILLVQVLLLRSRAVLGLSFGLVACVVALVLGLCFAHEFLRCCPARRVLQAISES
VETQPLLRLSLAILTIGSLLSVAIVNLLLMPFLAPELPAGNQTSPSPMDVGNTCEPLLYY
TCSCILAFVACSVFLRMSLELKVVLLTTALVAYLVLFNIHPCWRLDCCGLVANLTETNGT
LSSPPCVWKDPKVMINFYLVLFYVTLLMLSRQIDYYCRLDCLWKTKFKKEHEEFETMENV
NRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGLEC
LRLLNEIIADFDELLLKPKFSSVEKIKTIGSTYMAAAGLSSPSGTENQDLERQRAHIGIM
VEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRMES
TGELGKIQVTEETCATLQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3231 nt   +upstreamnt  +downstreamnt
atgccggccaaggggcgctatttcctcaacgagggcggagagggcccggaccagacggcg
ctgtacgagaagtaccggctcaccagtcagcatgggccgctgctgctcacgctcctgctg
gtggctgtcaccgcctgtattgccctcattgttatcaccttcgtctgcggggacccctcc
ggacaccaggctgtcctggggatggcgttcttcacacttgccttgtttgtgactctctac
gtgctggtgtatatggagtgtcttgtccggcggtggctcaggaccctggcgctggtcatc
tgggtctgcctcatgatgctgggctacacgctggtgttggactcgtggatgaaggctgcc
ccgacctgggctcaggtgccctttttcctgttcatcgtcttcgtggtgtacacgctgctg
cccttcagcatgcggggggccatcatggcagggggagtctccagcatctcccacctcctg
gtgctcggagttctgatgggggccttcacgaagcccagcgactgggtggtacggcagctg
gtggccaatgctgtcatcttcctgtgtgggaacctcacgggtgccttccacaagcaccag
atgcaggacgcctcccgagagctcttcacctacgccgtgaagtgcatccagatccgtcgg
aagctgcggatcgagaaacgccagcaggagaacctgctgctgtcggtgttgccggcccac
atctccatgggcatgaagctcgctatcatcgagcggctcaaggagcgtggagaccgccgc
tatgtgcccgacaacaacttccacagcctgtacgtcaagcggcaccagaatgtcagcatc
ctttatgccgacatcgtgggcttcacgcggctggccagcgactgctcccccaaagagttg
gtggtggtgctgaacgagctcttcggcaagtttgaccagatcgccaaggccaacgagtgt
atgcggatcaagatcctgggcgactgctactactgcgtgtcgggtctgcctgtgtccctg
cccacccacgcccggaactgcgtgaagatggggctggacatctgtgaagccattaagcag
gtgcgagaggccacgggtgtggacatcagcatgcgtgtgggcatacactcggggaacgtg
ctgtgtggggtcattgggctgcgcaaatggcagtacgatgtgtggtcccacgacgtgtcc
ctggccaacaggatggaggcggctggagtccctggccgggtgcacatcacagaggcgacg
ctgaagcacctggacaaggcgtatgaggtggaagacgggcacgggcagcagcgggacccc
tacctgaaggagatgaacattcgcacctacctggtcattgacccccggagccagcagccg
cccccgcccagccagcacctccccaagcccaagggggacgcggccctgaagatgcgggcg
tctgtgcgcatgacccgctacctggagtcctggggggctgcacggccctttgcacacctc
aaccaccgtgagagcgtgagcagcggcgagaccccagtccccagcgggcggaggcccaag
accattcccctgcggcgccaccggacccctgacaggagttcgtcccccaaggggcggtcg
gaggatgactcatatgatgaggagatgctgtcggccattgaggggctgagctccacgagg
ccctgctgctccaagtccgatgacttctccaccttcgggtctatcttcctggagaaggat
ttcgagcgagagtaccgcctggcgcccatcccccgggcccgccactacttcgcctgcgcc
agcctcatcttcgtctgcatcctgctggtccaggtcctgctcctgcgcagcagggctgtt
cttggtttgtccttcgggctggtggcctgtgtggtggcgctggtgctgggcctgtgcttc
gcccatgagttcttgaggtgctgcccggcccgaagggtgttgcaggccatctctgagagt
gtggagacccagcccctgctgcgcttgtccctggccatcctgactattggcagcctgctc
agtgtcgccatcgtcaacctgctgctgatgccttttctggccccagagctgcctgcgggc
aaccagacgagcccaagcccgatggatgtgggcaacacgtgtgagcccctcctgtattac
acctgtagctgcatcctggcctttgtcgcttgctcggtcttcctgcggatgagcctggag
ctgaaggttgtgctgttgaccacggccttggtggcctacctggtgctcttcaacatccac
ccgtgctggcggttggactgctgtggcctcgtggccaacctcaccgagaccaacggaacc
ctcagctccccaccgtgtgtgtggaaggacccgaaggtgatgatcaatttctatctggtt
ctgttttacgtcaccctcctcatgctctccagacagattgactactactgccgcttggac
tgtttgtggaagaccaagttcaagaaggaacacgaggagtttgaaaccatggagaatgtg
aaccgccttcttctggagaatgtcttgcctgcccacgtggccgctcacttcattggtgac
aagttaaatgaggactggtaccatcagtcctacgactgcgtgtgtgtcatgttcgcgtcc
gtgccggacttcaaagtcttctacacggagtgcgatgtcaacaaggaggggctggagtgt
ctgcgcctgctgaacgagatcattgccgactttgatgagctgctcctgaagcccaagttc
agcagcgtggagaagatcaagaccatcggcagcacgtacatggcggctgcagggctcagc
agcccctcagggaccgagaaccaggacctggagcggcagcgtgcacacatcggcatcatg
gtggagttcagcatcgccctgatgagcaagctggacggcatcaaccggcactccttcaac
tccttccgcctccgcgtcggcataaaccacgggcccgtgattgctggagtgatcggggca
cggaagcctcagtatgacatctggggaaacacggtcaacgttgctagccggatggagagc
actggagaacttggcaagatccaggttactgaagagacgtgcgccaccctccagggacta
ggttactcttgcgaatgccggggactgatcaacgtcaaaggcaaaggcgagctgaggact
tactttgtctgtacagacactgccaagttccaagggctgggactgaactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157825
Entry
111157825         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111157825
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111157825
   04371 Apelin signaling pathway
    111157825
   04072 Phospholipase D signaling pathway
    111157825
   04024 cAMP signaling pathway
    111157825
   04022 cGMP-PKG signaling pathway
    111157825
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111157825
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111157825
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111157825
   04062 Chemokine signaling pathway
    111157825
  09152 Endocrine system
   04911 Insulin secretion
    111157825
   04923 Regulation of lipolysis in adipocytes
    111157825
   04912 GnRH signaling pathway
    111157825
   04913 Ovarian steroidogenesis
    111157825
   04915 Estrogen signaling pathway
    111157825
   04914 Progesterone-mediated oocyte maturation
    111157825
   04921 Oxytocin signaling pathway
    111157825
   04926 Relaxin signaling pathway
    111157825
   04935 Growth hormone synthesis, secretion and action
    111157825
   04918 Thyroid hormone synthesis
    111157825
   04928 Parathyroid hormone synthesis, secretion and action
    111157825
   04916 Melanogenesis
    111157825
   04924 Renin secretion
    111157825
   04925 Aldosterone synthesis and secretion
    111157825
   04927 Cortisol synthesis and secretion
    111157825
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111157825
   04270 Vascular smooth muscle contraction
    111157825
  09154 Digestive system
   04970 Salivary secretion
    111157825
   04971 Gastric acid secretion
    111157825
   04972 Pancreatic secretion
    111157825
   04976 Bile secretion
    111157825
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111157825
   04961 Endocrine and other factor-regulated calcium reabsorption
    111157825
  09156 Nervous system
   04724 Glutamatergic synapse
    111157825
   04727 GABAergic synapse
    111157825
   04725 Cholinergic synapse
    111157825
   04723 Retrograde endocannabinoid signaling
    111157825
  09157 Sensory system
   04742 Taste transduction
    111157825
   04750 Inflammatory mediator regulation of TRP channels
    111157825
  09149 Aging
   04211 Longevity regulating pathway
    111157825
   04213 Longevity regulating pathway - multiple species
    111157825
  09159 Environmental adaptation
   04713 Circadian entrainment
    111157825
   04714 Thermogenesis
    111157825
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157825
  09165 Substance dependence
   05032 Morphine addiction
    111157825
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111157825
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111157825
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111157825
   05163 Human cytomegalovirus infection
    111157825
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111157825
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111157825
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 111157825
NCBI-ProteinID: XP_022375201
UniProt: A0A2Y9KMN5
LinkDB
Position
Unknown
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRTGGFCTPRYMSCLREAQPPSPSPAAPP
RCPWQDEAFIRRGGPGKGTELGLRAVALGFEDTEATAAVGVADVVPDGSPRRRWSCWRRL
AQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAMLVLLTAVLLAFHAAPAPPQPAYVT
LLACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLGPRWAPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPHSIVMLGIYAGTFLLLLITVLTCAVSSCGS
LFPKALRRLSRSIVRSRAHSTVVGIFSVLLVFTSAIANMFTCNHTPIRNCAARMLNVTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMV
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGPDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPPS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcgtggtttagtggcctcctggtccccaaagtggatgaacggaaaacagcctggggt
gagcgcaatgggcagaagcgtccgcgccgtgggacccggacaggtggcttctgcacgccc
cgctacatgagctgcctccgggaggcccagccccccagtcccagccccgctgctccccca
cggtgcccctggcaggacgaggccttcatccggaggggtggcccgggcaagggcactgag
ctggggctgcgggcagtggccctgggctttgaggacacggaggcgacggcagcagtgggg
gtggccgatgtggtgcccgacgggagccccaggcgtcggtggtcgtgctggcggcgtctg
gcccaggtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgg
tacttcttccagatgaaccagagcagcctgacactgctgatggccatgctggtgctgctg
acagcggtgctgctggccttccacgcagcgcctgcccccccgcagcctgcctatgtgacc
ctgctggcctgtgccgccaccctcttcgtggcgctcatggtggtgtgcaaccggcacagc
ttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcagctgtg
caggtggggggcgccctggcggctgacccccgcagcccctcggcgggcctctggtgtccc
gtgtttttcgtctacatcacctacacgctcctgcccatccgcatgcgggcggctgtcttc
agtggcctgggcctctccaccctgcatctgatcttggcctggcaactcaaccgcggggac
gccttcctctggaagcagctgggcgccaacatgctgctgttcctctgtaccaacgtcatt
ggcatctgcacacactacccggcggaggtgtcccagcgccaggcctttcaggagacccgc
ggttatatccaggcccggctgcacctgcagcacgagaaccggcagcaggaacggctgctg
ctgtccgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctgttt
gcggacattgaaggcttcaccagcctggcgtcccagtgcactgcacaggagctggtcatg
accctgaacgagctctttgcccggtttgacaagctggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgtgtgtcggggctgccggaggcccgggcagac
catgcccactgctgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgc
gaggtcacaggtgtgaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgt
ggtgtcctcggcctgcggaaatggcagttcgacgtgtggtccaatgacgtgacactggcc
aaccacatggaggcggggggccgggccggccgcatccacatcacccgggccacgctgcag
tacttgaatggggactacgaggtggagccaggccgaggcggtgagcggaacgcctacctc
aaggagcagcacatcgagaccttcctcatcctgggagccagccagaaacggaaagaggag
aaggccatgctggccaagctgcagcggacgcgggccaactccatggaagggctggggcca
cgctgggcgcccgaccgcgccttctcccggaccaaggactccaaggctttccgtcagatg
ggcattgatgattccagcaaggacaaccggggtgcccaagatgccctgaaccccgaggat
gaagtagatgagttcctgggccgtgccatcgacgcccgcagcatcgaccagctacggaag
gaccatgtgcgccgcttcctgctcaccttccagagagaggatcttgaaaagaagtactcg
cggaaggtggacccccgcttcggagcctacgtggcctgtgcgctgttggtcttctgcttc
atctgcttcatccagcttctcgtcttcccacactccatcgtgatgcttggtatctatgcc
ggtaccttcctgctgttgctgatcactgtgctgacctgtgccgtgtcctcatgtggctct
ctcttccccaaggccctgcgccgtctttcccgcagcattgtccgctctcgggcacacagc
actgtggttggcatcttttcagtcttgcttgtgttcacctctgccatcgccaacatgttc
acctgcaaccacacccccatacggaactgcgcagcccggatgctgaatgtgacacccgcc
gacatcaccgcctgtcacctgcagcagctcaattactctctgggtctggacgctcccctg
tgtgagggcaccgcacccacttgcagcttccctgagtacttcgttgggaacatgctgctg
agtctcttggccagctctgtcttcctgcacatcagcagcatcggaaagctggccatggtc
tttgtcctggggctcatctatttggtgctgcttctgctgggacccccagccaccatcttt
gacaactacgatctgctgcttggtgtccatggcttggcttcttccaacgagactttcgat
gggccggactgcccagctgccgggagggtggcactcaagtacatgacccccgtgattctg
ctggtgtttgcgctggcgctgtatctgcatgcccagcaggtggaatcgactgcccggctg
gacttcctctggaaactgcaggcaacaggggagaaggaggagatggaggaactgcaggca
tacaaccggaggctgctgcataacattctgcccaaggacgtggctgcccacttcctggcc
cgggagcgtcggaacgatgagctctactaccagtcgtgtgaatgtgtggccgtcatgttt
gcctccattgccaacttttctgagttctatgtggagctggaggcaaacaatgagggcgtc
gagtgcctgcggctgctcaatgagatcattgctgactttgatgagatcatcagcgaggag
cgcttccggcagctggagaagatcaagacgatcgggagcacctacatggcggcctcagga
ctgaacgccagcacctacgatcaggccggccgctcccacatcactgccttggcagactat
gccatgcggctcatggagcagatgaaacacatcaacgagcactccttcaacaatttccag
atgaagattgggctgaacatgggcccagttgtggcaggcgtcattggggctcggaagccg
cagtatgacatctgggggaacacagtgaatgtctctagccgtatggacagcacgggtgtc
cctgaccgaatccaggtgaccacggacttgtaccaggttctagctgccaaaggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggcccccccagttag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162403
Entry
111162403         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04742  Taste transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111162403
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111162403
   04371 Apelin signaling pathway
    111162403
   04020 Calcium signaling pathway
    111162403
   04072 Phospholipase D signaling pathway
    111162403
   04024 cAMP signaling pathway
    111162403
   04022 cGMP-PKG signaling pathway
    111162403
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111162403
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111162403
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111162403
   04062 Chemokine signaling pathway
    111162403
  09152 Endocrine system
   04911 Insulin secretion
    111162403
   04923 Regulation of lipolysis in adipocytes
    111162403
   04912 GnRH signaling pathway
    111162403
   04913 Ovarian steroidogenesis
    111162403
   04915 Estrogen signaling pathway
    111162403
   04914 Progesterone-mediated oocyte maturation
    111162403
   04921 Oxytocin signaling pathway
    111162403
   04926 Relaxin signaling pathway
    111162403
   04935 Growth hormone synthesis, secretion and action
    111162403
   04918 Thyroid hormone synthesis
    111162403
   04928 Parathyroid hormone synthesis, secretion and action
    111162403
   04916 Melanogenesis
    111162403
   04925 Aldosterone synthesis and secretion
    111162403
   04927 Cortisol synthesis and secretion
    111162403
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111162403
   04270 Vascular smooth muscle contraction
    111162403
  09154 Digestive system
   04970 Salivary secretion
    111162403
   04971 Gastric acid secretion
    111162403
   04972 Pancreatic secretion
    111162403
   04976 Bile secretion
    111162403
  09156 Nervous system
   04724 Glutamatergic synapse
    111162403
   04727 GABAergic synapse
    111162403
   04725 Cholinergic synapse
    111162403
   04723 Retrograde endocannabinoid signaling
    111162403
  09157 Sensory system
   04742 Taste transduction
    111162403
   04750 Inflammatory mediator regulation of TRP channels
    111162403
  09149 Aging
   04211 Longevity regulating pathway
    111162403
   04213 Longevity regulating pathway - multiple species
    111162403
  09159 Environmental adaptation
   04713 Circadian entrainment
    111162403
   04714 Thermogenesis
    111162403
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162403
  09165 Substance dependence
   05032 Morphine addiction
    111162403
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111162403
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111162403
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111162403
   05163 Human cytomegalovirus infection
    111162403
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111162403
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111162403
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 111162403
NCBI-ProteinID: XP_022382514
UniProt: A0A2Y9LFZ9
LinkDB
Position
Unknown
AA seq 1113 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLAMLAVASASGRDLVSDPG
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSVLVWAALLGLGHGFLFTGGLVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSRPPLLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALRSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDVSMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHLESPVSTSTPLPEKAFASFSPQWSLDRSRTPRGLDEDLDTGDAK
FFQVIEQLNSQKQWKQSKDFSPLTLYFREKELEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTVRWAGGVEVVSWALTTTWPEMGYP
SHMAKVLVLLPQKCVLKGPKMLHWLPTLSGLVATRPGLRVALGTATILLVFVMAITSLLF
LPAASNCPSRAPNVSSVAFNLSWELPGSLPLISVPYSMHCCVLGFLSCSLFLHMSFELKL
LLLLLWLGASCSLFLYSHAWLSDCLIARLYPDPLDSRPGVLKEPKLMGAVSFFIFFFTLL
VLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDL
YHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKI
KTIGSTYMAATGLNATSGQDTQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLR
VGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARVLQSLGYTCY
SRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLA
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggctcgcctcttcagtccccggccgccccccagcgaagatctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctgctgctgctggtgatcgtgctctgcgcg
ctcctggcgatgctggctgtcgcgtcagccagcggcagggatctagtttcagacccgggc
ttcctgaccactgtgctgtgtgcactgggtggcttctcgcttctcctgggcctggcttcc
cgtgagcaacgactgcagcgctggacacgtcccctatcggtcctcgtgtgggcagcgcta
cttgggctaggccacggcttcctgttcactgggggcctggtgagcgcctgggaccaggtg
tccttttttctcttcatcatcttcacggtgtatgccatgttgcccttgggcatgcgggat
gccgcagctgcgggccttgcttcatcactgtcccacctgctggtccttgggctgtacctt
gggcctcagccggactcccggccgccgctgctgccccagctggcagcaaacgccgtgttg
ttcttgtgcgggaacgtggctggagcctatcacaaggcactgatggagcgcgcgctccgc
gccacgttccgggaggcccttcggtccctgcactcgcgccggaggctggacactgagaag
aagcaccaggaacacctactcttgtccatccttcctgcctacttggcccgagagatgaag
gcagagatcatggcacggcttcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagtgagtgctcccctaaggagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagattctg
ggagactgttactactgtgtctctgggctcccactttccctgcccgaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactccgcgcagccactggc
gtggacatcaacatgcgtgtgggcgtgcattcgggcagcgtgctctgtggagtcatcggg
ctgcagaagtggcagtatgacgtctggtcccatgatgtcacgctggccaaccacatggag
gcgggtggcgtgccaggacgagtgcatattacaggggctaccctggccttgctagcaggg
gcctacgctgtagaggatgtatccatggaacaccgggacccatatcttcgggagctaggg
gagcccacctacctcgtcatcgatccccgggctgaggaggaggatgagaagggcactgca
ggagggctgctgtcctctctcgagggccccaagatgcgtccatcactgttgatgacgcgc
tacctggagtcctggggcgcggccaagccttttgcccacctgagccacctagagagccct
gtgtccacctctacccctctcccggagaaggcctttgcctccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgaagacctggatactggggatgccaag
ttcttccaagtcatcgaacagctcaactctcagaaacaatggaagcagtcaaaggacttc
agcccactgacactgtacttcagagagaaggagctggagaaagagtatcgactctctgcc
ctccccgccttcaaatactatgcagcctgcaccttcctggtcttcctctccaatttcatc
atccagatgctggtgaccaacaggcccccagctctggccatcacctatagcatcaccttc
cttctcttcctcctcctcctcttcgtctgcttctcagagcacctgacggtgaggtgggct
gggggggtggaagtggtgagctgggcccttaccacgacctggcctgagatggggtacccc
agccacatggctaaggttcttgtgctccttccacagaagtgtgtcttgaaaggccccaag
atgctacactggcttcccacactgtctggcttggtggccacccggcccggactgcgagtt
gccctgggcactgccaccatcctcctcgtttttgtcatggctattaccagcctgttgttc
ttaccagcagcatcaaactgcccttcccgggctcccaatgtgtcctccgtggctttcaac
ctctcctgggagctccctgggtccctgcctctcatcagcgtcccgtactctatgcactgc
tgcgtgctggggttcctgtcctgctccctctttctgcacatgagctttgagctgaagttg
ctgctgctcctgctgtggctgggggcctcctgctccctcttcctgtactcccatgcctgg
ctgtccgactgccttatcgcccgcctctatccagatcccttggactccaggccaggggtg
ctgaaggagcccaaactcatgggagctgtctccttcttcatcttcttcttcaccctccta
gtcctggctcggcagaacgagtattactgccgcctggattttctgtggaagaagaagctg
cggcaggagcaggaagagacagaaacaatggagaacctgactcggctgctgctagagaat
gtgctccccgcacacgtggccccccagttcatcggccagaaccggcgcaatgaggatctc
taccaccaatcctacgagtgtgtctgtgtcctgttcgcctcagttccagactttaaggaa
ttttactctgaatccaacatcaaccacgagggtctagagtgtctgcggctgctcaatgag
atcattgcagattttgatgagctgctctcaaagcccaagtttagtggggtggagaagatc
aaaaccatcggcagcacctacatggcagccacaggcttaaacgccacctctggacaggac
acacagcaggatgctgagcgaagctgcagccacctgggcaccatggtggagtttgcagtg
gcccttggatcaaagctggatgtcatcaataagcactcattcaacaacttccgcctgcgt
gtggggttgaaccacggacctgtagttgctggagtgattggggcccagaagcctcagtat
gacatctggggcaacacggtgaacgttgcgagccgcatggagagtacaggagtcctgggc
aagatccaagtgactgaagagacagcccgggtgttgcagtccttaggctatacctgctac
agccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctatttcctgaacaca
gatttgacacgaactggccctccctcagccaccctagcctga

DBGET integrated database retrieval system