KEGG   Enhydra lutris kenyoni (northern sea otter): 111146744
Entry
111146744         CDS       T05871                                 

Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04062  Chemokine signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04670  Leukocyte transendothelial migration
elk04810  Regulation of actin cytoskeleton
elk04935  Growth hormone synthesis, secretion and action
elk05100  Bacterial invasion of epithelial cells
elk05135  Yersinia infection
elk05146  Amoebiasis
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05205  Proteoglycans in cancer
elk05222  Small cell lung cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111146744
   04370 VEGF signaling pathway
    111146744
   04151 PI3K-Akt signaling pathway
    111146744
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111146744
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111146744
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111146744
   04062 Chemokine signaling pathway
    111146744
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111146744
  09158 Development and regeneration
   04360 Axon guidance
    111146744
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111146744
   05202 Transcriptional misregulation in cancer
    111146744
   05205 Proteoglycans in cancer
    111146744
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111146744
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111146744
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111146744
   05100 Bacterial invasion of epithelial cells
    111146744
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111146744
   05163 Human cytomegalovirus infection
    111146744
   05165 Human papillomavirus infection
    111146744
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111146744
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111146744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111146744
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111146744
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111146744
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  FAK family
   111146744
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111146744
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 111146744
NCBI-ProteinID: XP_022358127
UniProt: A0A2Y9JAS7
LinkDB
Position
Unknown
AA seq 1140 aa
MWLELAGRAALRPAGAVCMEKSGCSPFPMCWAKEYDRHTASAKIMAAAYLDPNLNHTPHS
STKTHLGAGAERSPGAMERVLKVFHYFENSSEPATWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMSEVADRVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTL
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKP
ANSEKQGVRTHAVSVSGVSPRQHKVKKARRFLPLVFCSHEPSPTDEISGDETDDYAEIID
EEDTYTIPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKT
CKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRK
YSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDST
YYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRI
ENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMES
RRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMAQTNHYQVSGYPGSHGVTA
LAGSIYPGQASLLDQTDSWNHRAQEIPMWQPSMEDSAVPDLRGIGQVLPAHLMEERLVRQ
QQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPTGNQHIYQPVGKPDPAAPPKK
PPRPGAPGHLGSLASLSSPGDSYNEGVKPWRLPPQEISPPPTANLDRSNDRVYENVTGLV
KAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETLPVLPASTHREIEMAQKLLNS
DLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLRMLGPTRPH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgtggctggaactggcgggccgagcggccctgagaccagcaggtgccgtctgtatggag
aagagcggctgtagtccatttccaatgtgttgggctaaagagtatgacagacacacagcg
tcggccaaaataatggcggccgcttaccttgacccaaacttgaaccacacaccgcattcg
agtaccaagactcacctgggcgccggcgcggagcggtcccccggggcaatggagcgggtg
ctgaaagtctttcattactttgaaaacagcagtgaaccagctacttgggccagtatcatc
aggcacggggatgcgacggacgtccggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgcctcagtcacctgcggtcagaggaggttcac
tggctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcacaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttacggaagacaagccaactctgaatttcttctaccaacaggtcaagagcgactacatg
tcagaggtagctgaccgtgtggaccaggacattgctctgaagctgggctgtctggaaatc
cggcgctcatactgggagatgcgaggcaacgcgctcgagaagaagtccaactacgaagtg
ttggaaaaagatgttggtttgaagcgattttttcctaggagtttactggattctgtcaag
gccaaaacgctacggaagctgatccaacagacgtttagacagtttgccaaccttaacaga
gaagaaagtattctgaaattctttgagatcctctccccggtgtacagattcgataaagaa
tgcttcaagtgtgctctgggttcaagctggattatctcagtggaattggcaattggcccc
gaagaaggcatcagttacctcacggacaagggctgcaaccccacacatctggctgacttc
aatcaagtgcagaccattcagtactcgaacagcgaagacaaggacaggaaggggacactg
cagctgaaaatcgccggcgcgcccgagcctctgacggtgacggcgccgtccctaaccatc
gctgagaatatggcggacttgatagacgggtactgccggctggtgaacggggccacacag
tcttttatcatcagaccccagaaagaaggtgagcgggctttgccatcgataccaaagccg
gccaacagcgagaagcaaggcgtgcggacacatgcggtctccgtgtcaggagtcagtccc
cgccagcataaagttaagaaagctaggcgctttctccctttggtcttctgttcccatgag
ccttctcctaccgatgaaattagtggggacgagacggatgattatgctgagatcatagac
gaagaagacacctacaccataccctcgaaaagctatggaatagatgaagccagggattat
gagattcagagagaaagaatcgagcttggacggtgcatcggggaaggccagtttggagac
gtccatcaaggcgtctacatgagcccagagaacccagcgctggcggttgcaattaaaaca
tgtaaaaactgtacttcggacagcgtgagagagaaattccttcaagaagccttgacgatg
cgccagttcgaccaccctcacattgtgaagctgatcggtgtcatcacggagaaccccgtc
tggataatcatggagctgtgcacgctcggagagctgaggtcatttctgcaagtaaggaag
tacagtttggatctggcgtctctgatcctttatgcctatcagcttagtacagctctcgcg
tatctagagagcaaaagatttgtgcacagggacattgctgctcggaacgttctggtgtcc
tcaaatgattgtgtaaaactaggagactttggattatcccgatacatggaagacagtact
tactacaaagcttccaaaggaaaattgccaattaagtggatggctccagagtccatcaat
tttcgacgttttacctcagctagtgatgtgtggatgtttggtgtgtgtatgtgggagata
ctgatgcacggtgtgaagccctttcaaggagtgaagaacaatgacgtgattggtcggatt
gagaacggggagaggctgccgatgcctccgaactgtcctccgaccctctacagccttatg
acgaagtgctgggcctatgaccccagcaggcggccccggttcactgagctcaaagctcag
ctcagcacaatcctggaggaggagaaggtccagcaggaagagcggatgaggatggagtcc
agaagacaggtcacggtgtcctgggactccggagggtccgacgaagcgccgcccaagccc
agcagacccggttaccccagtccaaggtccagcgaaggattttaccccagtcctcagcac
atggcacagaccaatcattaccaggtctctggctatcctggttcccatggggtcacggcc
ttggctggcagcatctacccgggccaggcatctctcttggaccagacggactcctggaat
cacagagcgcaggagataccaatgtggcagcccagcatggaggactcggcggtaccggac
ctgcgcgggatcgggcaggtgttgccggcccacctgatggaggagcggctggtccggcag
cagcaggagatggaggaagaccagcgctggctggaaaaagaggagaggtttctgaaaccc
gacgtccggctctctcgaggcagcattgacagggaagacggaagcctccagggcccgact
ggaaaccaacacatctatcagcctgtggggaagccagatcctgcagctccgccaaagaaa
ccgccacggcctggggcccccggtcacctgggcagcctcgccagcctcagcagccccggg
gacagttacaatgagggcgtcaagccatggaggcttccgcctcaggaaatcagccccccg
cccacggccaacctggaccggtccaacgacagggtgtacgagaatgtgacgggcctggtg
aaggctgtcatcgaaatgtccagcaagatccagccagccccgccggaggagtacgttccc
atggtgaaggaagtcggcctggccctgcggacattactggccaccgtggacgagaccctt
ccagtcctgccagccagcactcaccgagagattgagatggcccagaagctgttgaactcc
gacctgggcgagctcatcaacaagatgaaactggcccagcagtacgtcatgaccagcctc
cagcaggagtataaaaagcaaatgctgaccgctgctcacgccctggccgtggacgccaaa
aacttactcgatgtcattgaccaagcgagactgcggatgcttggacccacgaggccgcac
tga

DBGET integrated database retrieval system